PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Phvul.002G056900.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 185aa MW: 21090.7 Da PI: 8.4893 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 63.5 | 4.2e-20 | 15 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+eEd++l+++++ +G ++Wkt+a + g++R++k+c++rw++yl Phvul.002G056900.1 15 RGAWTAEEDQKLAQCIEIHGAKRWKTVAIKSGLNRCGKSCRLRWLNYL 62 89********************************************97 PP | |||||||
2 | Myb_DNA-binding | 51.9 | 1.7e-16 | 68 | 112 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg+ + eE++l+ +++k+lG++ W++Ia++++ gRt++++k++w++ Phvul.002G056900.1 68 RGNISVEEEDLITRLHKLLGNR-WSLIAKRLP-GRTDNEIKNYWNTC 112 78999*****************.*********.***********986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 25.032 | 10 | 66 | IPR017930 | Myb domain |
SMART | SM00717 | 4.8E-16 | 14 | 64 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.06E-29 | 14 | 109 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 6.6E-18 | 15 | 62 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.4E-23 | 16 | 69 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.89E-11 | 17 | 62 | No hit | No description |
PROSITE profile | PS51294 | 19.424 | 67 | 117 | IPR017930 | Myb domain |
SMART | SM00717 | 5.1E-14 | 67 | 115 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 8.4E-15 | 68 | 112 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 7.4E-25 | 70 | 117 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 5.91E-11 | 72 | 111 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 185 aa Download sequence Send to blast |
MAPQNNETPK KTNNRGAWTA EEDQKLAQCI EIHGAKRWKT VAIKSGLNRC GKSCRLRWLN 60 YLRPNIKRGN ISVEEEDLIT RLHKLLGNRW SLIAKRLPGR TDNEIKNYWN TCLCKKVNHH 120 TKVKPETSMA QPTHSTQNTE EKVAAENKEG TDHDDGSGDS EVNFDVNEFF NFSIEGPYAL 180 DWVI* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 5e-29 | 15 | 117 | 4 | 105 | MYB PROTO-ONCOGENE PROTEIN |
1h8a_C | 5e-29 | 14 | 117 | 26 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Phvul.002G056900.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015043 | 8e-95 | AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003516658.1 | 1e-115 | transcription factor MYB32 | ||||
Refseq | XP_028215100.1 | 1e-115 | transcription factor MYB32-like | ||||
Swissprot | P10290 | 2e-48 | MYBC_MAIZE; Anthocyanin regulatory C1 protein | ||||
TrEMBL | A0A445M5V2 | 1e-113 | A0A445M5V2_GLYSO; Anthocyanin regulatory C1 protein | ||||
TrEMBL | K7K4Z0 | 1e-113 | K7K4Z0_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA01G41610.2 | 1e-114 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2148 | 32 | 88 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G40330.1 | 2e-50 | myb domain protein 23 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Phvul.002G056900.1 |