PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Phvul.001G039900.1 | ||||||||
Common Name | PHAVU_001G039900g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 153aa MW: 17363.9 Da PI: 5.289 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 100.1 | 1.4e-31 | 91 | 149 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYG+K+vk++++pr+YYrC+ gC+vkk+ver+++dp++v++tYeg+H+h+ Phvul.001G039900.1 91 LDDGYRWRKYGKKMVKNNPNPRNYYRCSVDGCSVKKRVERDKDDPRCVITTYEGSHTHP 149 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 1.3E-33 | 78 | 150 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.44E-28 | 84 | 150 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 31.054 | 86 | 151 | IPR003657 | WRKY domain |
SMART | SM00774 | 4.9E-36 | 91 | 150 | IPR003657 | WRKY domain |
Pfam | PF03106 | 2.5E-25 | 92 | 149 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 153 aa Download sequence Send to blast |
MTDNNPRPPP DTPDSDDFCN QWPFELSEYL QLDDFESFSP ENNVSNQVHL SGSGGSGSYF 60 EGSSNNPSGR ENRQVVRDRV AFKTISEIEV LDDGYRWRKY GKKMVKNNPN PRNYYRCSVD 120 GCSVKKRVER DKDDPRCVIT TYEGSHTHPS SS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 2e-27 | 81 | 148 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 2e-27 | 81 | 148 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Phvul.001G039900.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015036 | 4e-56 | AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007161066.1 | 1e-110 | hypothetical protein PHAVU_001G039900g | ||||
TrEMBL | V7CUU4 | 1e-108 | V7CUU4_PHAVU; Uncharacterized protein | ||||
STRING | XP_007161066.1 | 1e-109 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1120 | 34 | 110 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26170.1 | 6e-41 | WRKY DNA-binding protein 50 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Phvul.001G039900.1 |
Entrez Gene | 18640313 |