PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.8KG076600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MYB
Protein Properties Length: 230aa    MW: 24477.8 Da    PI: 9.8359
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.8KG076600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.93.6e-16450148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         + +WT+eEd  l + v+ +G+ +W++I++ ++ gR +k+c++rw ++l
  Pavir.8KG076600.1.p  4 KSAWTKEEDAALREQVRAHGPQNWAAISAALP-GRNPKSCRLRWCQHL 50
                         579*****************************.***********9986 PP

2Myb_DNA-binding47.83.4e-1559101347
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          ++T+eEd +++ ++++++++ W+tIa  ++ gR+++ +k+rw+++
  Pavir.8KG076600.1.p  59 PFTPEEDAKIASLHRLYPNK-WATIAGFLP-GRSDNAVKNRWNSV 101
                          79******************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.457154IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.6E-19252IPR009057Homeodomain-like
SuperFamilySSF466892.02E-29398IPR009057Homeodomain-like
SMARTSM007175.1E-16352IPR001005SANT/Myb domain
PfamPF002492.4E-15450IPR001005SANT/Myb domain
CDDcd001676.10E-15650No hitNo description
SMARTSM007172.0E-1256104IPR001005SANT/Myb domain
PROSITE profilePS5129416.32558106IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.9E-1959102IPR009057Homeodomain-like
PfamPF002497.2E-1459102IPR001005SANT/Myb domain
CDDcd001679.43E-1259102No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MMKKSAWTKE EDAALREQVR AHGPQNWAAI SAALPGRNPK SCRLRWCQHL APGVDAARPF  60
TPEEDAKIAS LHRLYPNKWA TIAGFLPGRS DNAVKNRWNS VLGKQPQPQH QRWALAAPLR  120
RVSDGTLPLF PLASGDVRAC GRSARVLRHP PPGGGDAGAA DLSGGACLEL FPLAPGDLVV  180
GSNGTSEAPE MDADRGDDDP TATGLRLWPC TRAASMAAFK AMVQAVRAP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3zqc_A4e-2741052102MYB3
3zqc_D4e-2741052102MYB3
3zqc_G4e-2741052102MYB3
3zqc_J4e-2741052102MYB3
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.8KG076600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025798530.11e-132myb-related protein 308-like
TrEMBLA0A3L6SC901e-131A0A3L6SC90_PANMI; Uncharacterized protein
STRINGPavir.Hb01126.1.p1e-165(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP49603465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.16e-36myb domain protein 77