PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pavir.7NG197300.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 202aa MW: 22542 Da PI: 4.7798 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 107.1 | 2.2e-33 | 7 | 124 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 lppGf+F P+deel+v++L++k++ +++ ++++++ +++++Pw+L+ k+ + ++wyfFs++ ++r+t +gyW++ d+ Pavir.7NG197300.1.p 7 LPPGFHFFPSDEELIVHFLRRKASLLPCQP-DIVPTILLNHYDPWELNDKALQAGNQWYFFSHAT--------QSRVTPNGYWSSICADE 87 79*************************999.89**************966667789******975........5799************* PP NAM 91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 +v+s +g ++glkktLvf g++++g +t+W+mhey+l Pavir.7NG197300.1.p 88 TVKS-GGCNIGLKKTLVFSIGESSEGIETNWIMHEYHL 124 ***9.99*****************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.11E-43 | 4 | 163 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 39.906 | 7 | 165 | IPR003441 | NAC domain |
Pfam | PF02365 | 3.1E-22 | 8 | 124 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 202 aa Download sequence Send to blast |
MGGASDLPPG FHFFPSDEEL IVHFLRRKAS LLPCQPDIVP TILLNHYDPW ELNDKALQAG 60 NQWYFFSHAT QSRVTPNGYW SSICADETVK SGGCNIGLKK TLVFSIGESS EGIETNWIMH 120 EYHLLDGRKV CSSSTSTSSS RKLHREKGHS NTESDNWVIC RVFDSTCGSQ ANFHEEGMEL 180 SCLDEVFLSL DDYDEVSLSN N* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3swm_A | 2e-36 | 7 | 170 | 20 | 173 | NAC domain-containing protein 19 |
3swm_B | 2e-36 | 7 | 170 | 20 | 173 | NAC domain-containing protein 19 |
3swm_C | 2e-36 | 7 | 170 | 20 | 173 | NAC domain-containing protein 19 |
3swm_D | 2e-36 | 7 | 170 | 20 | 173 | NAC domain-containing protein 19 |
3swp_A | 2e-36 | 7 | 170 | 20 | 173 | NAC domain-containing protein 19 |
3swp_B | 2e-36 | 7 | 170 | 20 | 173 | NAC domain-containing protein 19 |
3swp_C | 2e-36 | 7 | 170 | 20 | 173 | NAC domain-containing protein 19 |
3swp_D | 2e-36 | 7 | 170 | 20 | 173 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Pvr.26181 | 1e-117 | root |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in root xylem vessels (PubMed:15923329). Expressed in stems, vascular tissue of cauline leaves and tracheary elements of sepals (PubMed:18069942). {ECO:0000269|PubMed:15923329, ECO:0000269|PubMed:18069942}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pavir.7NG197300.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025823281.1 | 1e-138 | NAC domain-containing protein 104-like isoform X1 | ||||
Swissprot | Q8GWK6 | 2e-62 | NC104_ARATH; NAC domain-containing protein 104 | ||||
TrEMBL | A0A3L6PXI4 | 1e-137 | A0A3L6PXI4_PANMI; NAC transcription factor 29-like | ||||
STRING | Pavir.J14631.1.p | 1e-149 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3667 | 36 | 79 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64530.1 | 1e-63 | xylem NAC domain 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pavir.7NG197300.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|