PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pavir.5KG585300.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 194aa MW: 21394.1 Da PI: 6.6443 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 32.8 | 1.5e-10 | 65 | 112 | 3 | 50 |
XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 el++ r+ NReA r++R++Kka + Lee+vk+L a N++L +l+ Pavir.5KG585300.1.p 65 ELRKPRKPLGNREAVRKYREKKKAHAAFLEEEVKKLRATNQQLLRRLQ 112 7899999999*********************************98887 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 1.7E-16 | 58 | 131 | No hit | No description |
SMART | SM00338 | 2.2E-11 | 63 | 130 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF07716 | 3.9E-13 | 64 | 120 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 8.921 | 65 | 112 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 2.06E-8 | 66 | 113 | No hit | No description |
CDD | cd14686 | 9.50E-11 | 70 | 121 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 194 aa Download sequence Send to blast |
MDDEVDLPSH LLFLHHEISC GFDDFLKSTT ACTHTHTCNP PGPSAAVHTH TCLHTHTQVV 60 ASDDELRKPR KPLGNREAVR KYREKKKAHA AFLEEEVKKL RATNQQLLRR LQGHAALEAE 120 VVRLRGLLFD VRGKIDAEID SFPFQKHSSV DSVICTEPPL SINTDAEVAA RVASSGGPTI 180 LDFEIDESGS ISR* |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Pvr.303 | 0.0 | callus| leaf| stem |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in the response to zinc ion deficiency. Binds to the consensus sequence 5'-[AG]TGTCGACA[CT]-3' also called zinc deficiency response element (ZDRE). The ZDRE sequence is conserved in the plant kingdom and present in the promoters of genes that constitute the primary response to zinc deficiency, comprising additional ZIP metal transporter genes (PubMed:20479230, PubMed:26306426). Required for zinc accumulation in roots. Mediates the expression of the zinc transporter ZIP12 during growth in zinc-deficient conditions. ZIP12 transporter is involved in zinc uptake in roots (PubMed:26306426). {ECO:0000269|PubMed:20479230, ECO:0000269|PubMed:26306426}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pavir.5KG585300.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by zinc deficiency. {ECO:0000269|PubMed:20479230}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025817245.1 | 1e-109 | basic leucine zipper 23-like | ||||
Refseq | XP_025817246.1 | 1e-109 | basic leucine zipper 23-like | ||||
Swissprot | Q8GTS2 | 5e-53 | BZP23_ARATH; Basic leucine zipper 23 | ||||
TrEMBL | A0A2T7DFJ7 | 1e-108 | A0A2T7DFJ7_9POAL; Uncharacterized protein | ||||
STRING | Pavir.Ea03172.1.p | 1e-140 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3831 | 36 | 75 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G16770.1 | 2e-55 | bZIP family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pavir.5KG585300.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|