PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT2G16770.1

Common Name

bZIP23

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

bZIP

Protein Properties

Length: 249aa MW: 27299.7 Da PI: 6.4986

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT2G16770.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	29.7	1.4e-09	79	122	8	51
HCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 8 rrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 +r NReA r++R++Kka+ + Le++v L+a N +L k+l+ AT2G16770.1 79 KRPLGNREAVRKYREKKKAKAASLEDEVMRLKAVNNQLLKRLQG 122 77788**********************************99974 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.20.5.170	3.8E-15	67	140	No hit	No description
SMART	SM00338	1.6E-10	72	139	IPR004827	Basic-leucine zipper domain
Pfam	PF07716	1.6E-15	73	129	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	8.554	74	121	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	1.06E-7	77	121	No hit	No description
CDD	cd14686	8.79E-12	78	130	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0071294	Biological Process	cellular response to zinc ion
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0005515	Molecular Function	protein binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000293	anatomy	guard cell

Sequence ? help Back to Top
Protein Sequence Length: 249 aa Download sequence Send to blast
MDDGELEFSN SNMGGELPSC SMDSFFDELL RDSHACTHTH TCNPPGPENT HTHTCLHVHT 60 KILPDKVSTD DTSESSGKKR PLGNREAVRK YREKKKAKAA SLEDEVMRLK AVNNQLLKRL 120 QGQAALEAEV TRLKCLLVDI RGRIDGEIGA FPYQKPAVTN VPYSYMMHPC NMQCDVDNLY 180 CLQNGNNGEG ASMNEQGLNG CEFDQLECLA NQNLAGKEIP VCSNGIGTFT VNGSGVNKRK 240 GEPRAAKAV

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.40238	0.0	flower\| root

Expression -- Microarray ? help Back to Top
Source	ID
Expression Atlas	AT2G16770
AtGenExpress	AT2G16770

Functional Description ? help Back to Top
Source	Description
TAIR	Basic-region leucine zipper (bZIP23) transcription factor involved in the adaptation to zinc deficiency. Binds ZDRE motifs.
UniProt	Transcription factor involved in the response to zinc ion deficiency. Binds to the consensus sequence 5'-[AG]TGTCGACA[CT]-3' also called zinc deficiency response element (ZDRE). The ZDRE sequence is conserved in the plant kingdom and present in the promoters of genes that constitute the primary response to zinc deficiency, comprising additional ZIP metal transporter genes (PubMed:20479230, PubMed:26306426). Required for zinc accumulation in roots. Mediates the expression of the zinc transporter ZIP12 during growth in zinc-deficient conditions. ZIP12 transporter is involved in zinc uptake in roots (PubMed:26306426). {ECO:0000269\|PubMed:20479230, ECO:0000269\|PubMed:26306426}.

Function -- GeneRIF ? help Back to Top
Studies indicate that zinc deficiency leads to the activation of bZIP9 and bZIP23. [PMID: 23851954]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT2G16770.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by zinc deficiency. {ECO:0000269\|PubMed:20479230}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Interaction ? help Back to Top
Source	Intact With
IntAct	Search Q8GTS2

Phenotype -- Disruption Phenotype ? help Back to Top
Source	Description
UniProt	DISRUPTION PHENOTYPE: No visible phenotype under normal growth conditions (PubMed:20479230, PubMed:26306426). Mutant seedlings grown under normal conditions accumulate reduced levels of zinc in roots. Mutant seedlings grown in zinc-depleted medium have reduced root length (PubMed:26306426). {ECO:0000269\|PubMed:20479230, ECO:0000269\|PubMed:26306426}.

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT2G16770

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT029022	0.0	BT029022.1 Arabidopsis thaliana At2g16770 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001324107.1	0.0	Basic-leucine zipper (bZIP) transcription factor family protein
Refseq	NP_179268.2	0.0	Basic-leucine zipper (bZIP) transcription factor family protein
Swissprot	Q8GTS2	0.0	BZP23_ARATH; Basic leucine zipper 23
TrEMBL	A0A178VYS8	0.0	A0A178VYS8_ARATH; BZIP23
STRING	AT2G16770.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM2036	28	79
Representative plant	OGRP1970	15	36

Link Out ? help Back to Top
Phytozome	AT2G16770.1
Entrez Gene	816178
iHOP	AT2G16770
wikigenes	AT2G16770

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Jakoby M, et al. bZIP transcription factors in Arabidopsis. Trends Plant Sci., 2002. 7(3): p. 106-11 [PMID:11906833] Seki M, et al. Functional annotation of a full-length Arabidopsis cDNA collection. Science, 2002. 296(5565): p. 141-5 [PMID:11910074] Satoh R,Fujita Y,Nakashima K,Shinozaki K,Yamaguchi-Shinozaki K A novel subgroup of bZIP proteins functions as transcriptional activators in hypoosmolarity-responsive expression of the ProDH gene in Arabidopsis. Plant Cell Physiol., 2004. 45(3): p. 309-17 [PMID:15047879] Deppmann CD, et al. Dimerization specificity of all 67 B-ZIP motifs in Arabidopsis thaliana: a comparison to Homo sapiens B-ZIP motifs. Nucleic Acids Res., 2004. 32(11): p. 3435-45 [PMID:15226410] Deppmann CD,Alvania RS,Taparowsky EJ Cross-species annotation of basic leucine zipper factor interactions: Insight into the evolution of closed interaction networks. Mol. Biol. Evol., 2006. 23(8): p. 1480-92 [PMID:16731568] Jaspers P, et al. Unequally redundant RCD1 and SRO1 mediate stress and developmental responses and interact with transcription factors. Plant J., 2009. 60(2): p. 268-79 [PMID:19548978] Rehrauer H, et al. AGRONOMICS1: a new resource for Arabidopsis transcriptome profiling. Plant Physiol., 2010. 152(2): p. 487-99 [PMID:20032078] Assun Arabidopsis thaliana transcription factors bZIP19 and bZIP23 regulate the adaptation to zinc deficiency. Proc. Natl. Acad. Sci. U.S.A., 2010. 107(22): p. 10296-301 [PMID:20479230] Causier B,Ashworth M,Guo W,Davies B The TOPLESS interactome: a framework for gene repression in Arabidopsis. Plant Physiol., 2012. 158(1): p. 423-38 [PMID:22065421] Assun Model of how plants sense zinc deficiency. Metallomics, 2013. 5(9): p. 1110-6 [PMID:23851954] Inaba S, et al. Identification of putative target genes of bZIP19, a transcription factor essential for Arabidopsis adaptation to Zn deficiency in roots. Plant J., 2015. 84(2): p. 323-34 [PMID:26306426] Azevedo H, et al. Transcriptomic profiling of Arabidopsis gene expression in response to varying micronutrient zinc supply. Genom Data, 2016. 7: p. 256-8 [PMID:26981422] Castro PH, et al. Phylogenetic analysis of F-bZIP transcription factors indicates conservation of the zinc deficiency response across land plants. Sci Rep, 2017. 7(1): p. 3806 [PMID:28630437] Nazri AZ,Griffin JHC,Peaston KA,Alexander-Webber DGA,Williams LE F-group bZIPs in barley-a role in Zn deficiency. Plant Cell Environ., 2017. 40(11): p. 2754-2770 [PMID:28763829] Ezer D, et al. The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470]