PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pavir.3NG317600.2.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 166aa MW: 19809.7 Da PI: 10.6866 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 48 | 2.8e-15 | 4 | 53 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48 r+rW +eEd l +v+q+G++ W++++++m+ + R +k+c +rw +yl Pavir.3NG317600.2.p 4 RQRWRPEEDAVLRAYVRQHGPREWHLVSQRMNvaLDRDAKSCLERWKNYL 53 89**********************************************97 PP | |||||||
2 | Myb_DNA-binding | 37.3 | 6.5e-12 | 59 | 103 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+ T eE+ l +++ +++G++ Wk+Ia++++ gRt+k + +w + Pavir.3NG317600.2.p 59 KGSLTDEEQRLVIRLQAKHGNK-WKKIAAEVP-GRTAKRLGKWWEVF 103 6778******************.*********.*****999999766 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 15.872 | 1 | 53 | IPR017930 | Myb domain |
SMART | SM00717 | 1.5E-11 | 3 | 55 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 9.16E-22 | 4 | 98 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 7.1E-21 | 6 | 60 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 8.53E-8 | 6 | 53 | No hit | No description |
Pfam | PF13921 | 1.5E-13 | 7 | 68 | No hit | No description |
PROSITE profile | PS51294 | 22.981 | 54 | 108 | IPR017930 | Myb domain |
SMART | SM00717 | 5.0E-10 | 58 | 106 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 8.7E-16 | 61 | 102 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 5.93E-7 | 63 | 104 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0008356 | Biological Process | asymmetric cell division | ||||
GO:0009615 | Biological Process | response to virus | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009733 | Biological Process | response to auxin | ||||
GO:0009739 | Biological Process | response to gibberellin | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0009753 | Biological Process | response to jasmonic acid | ||||
GO:0009944 | Biological Process | polarity specification of adaxial/abaxial axis | ||||
GO:0010338 | Biological Process | leaf formation | ||||
GO:0042742 | Biological Process | defense response to bacterium | ||||
GO:0045088 | Biological Process | regulation of innate immune response | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0046686 | Biological Process | response to cadmium ion | ||||
GO:0050832 | Biological Process | defense response to fungus | ||||
GO:0000793 | Cellular Component | condensed chromosome | ||||
GO:0005730 | Cellular Component | nucleolus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0042803 | Molecular Function | protein homodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 166 aa Download sequence Send to blast |
MKERQRWRPE EDAVLRAYVR QHGPREWHLV SQRMNVALDR DAKSCLERWK NYLRPGIKKG 60 SLTDEEQRLV IRLQAKHGNK WKKIAAEVPG RTAKRLGKWW EVFKEKQQRE LRDSRRPPPE 120 PSPDQRGSSN THYPAFLEQY DISLLPQQKL YSKAHEYSLT FFFLK* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1mse_C | 7e-15 | 7 | 100 | 7 | 97 | C-Myb DNA-Binding Domain |
1msf_C | 7e-15 | 7 | 100 | 7 | 97 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Pvr.1593 | 0.0 | stem |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in lateral organ promordia. {ECO:0000269|PubMed:10102816, ECO:0000269|PubMed:16243907}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor required for normal cell differentiation. Interacts directly with asymmetric leaves 2 (AS2) to repress the knox homeobox genes. {ECO:0000269|PubMed:10102816, ECO:0000269|PubMed:12750468, ECO:0000269|PubMed:9655808}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pavir.3NG317600.2.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF126489 | 1e-177 | AF126489.1 Zea mays rough sheath2 protein (rs2) gene, complete cds. | |||
GenBank | AF143447 | 1e-177 | AF143447.1 Zea mays rough sheath 2 (rs2) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001105509.1 | 4e-73 | protein rough sheath 2 | ||||
Swissprot | Q9S7B2 | 4e-74 | RS2_MAIZE; Protein rough sheath 2 | ||||
TrEMBL | A0A1E5V7B3 | 2e-72 | A0A1E5V7B3_9POAL; Protein rough sheath 2 (Fragment) | ||||
TrEMBL | A0A3L6T241 | 7e-72 | A0A3L6T241_PANMI; Protein rough sheath 2 | ||||
STRING | Pavir.Cb00486.1.p | 2e-87 | (Panicum virgatum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37630.1 | 5e-66 | MYB family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pavir.3NG317600.2.p |