PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT2G37630.1

Common Name

AS1, ATMYB91, ATPHAN, F13M22.13, MYB91, PHAN

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MYB

Protein Properties

Length: 367aa MW: 42243.1 Da PI: 9.5547

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT2G37630.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	46.4	9.1e-15	4	53	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48 r+rW+ eEd ll +v+q+G++ W++++++m+ ++R +k+c +rw +yl AT2G37630.1 4 RQRWSGEEDALLRAYVRQFGPREWHLVSERMNkpLNRDAKSCLERWKNYL 53 89**********************************************97 PP
2	Myb_DNA-binding	36.3	1.3e-11	59	103	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+ T+eE+ l +++ +++G++ Wk+Ia++++ gRt+k + +w + AT2G37630.1 59 KGSLTEEEQRLVIRLQEKHGNK-WKKIAAEVP-GRTAKRLGKWWEVF 103 6788****************.*****.***999999766 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	16.469	1	53	IPR017930	Myb domain
SMART	SM00717	1.7E-13	3	55	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	1.28E-21	4	98	IPR009057	Homeodomain-like
CDD	cd00167	9.17E-8	6	53	No hit	No description
Gene3D	G3DSA:1.10.10.60	8.2E-20	6	60	IPR009057	Homeodomain-like
Pfam	PF13921	3.8E-13	7	67	No hit	No description
PROSITE profile	PS51294	23.248	54	108	IPR017930	Myb domain
SMART	SM00717	3.2E-10	58	106	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	3.2E-15	61	102	IPR009057	Homeodomain-like
CDD	cd00167	7.81E-7	63	104	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006357	Biological Process	regulation of transcription from RNA polymerase II promoter
GO:0008356	Biological Process	asymmetric cell division
GO:0009615	Biological Process	response to virus
GO:0009651	Biological Process	response to salt stress
GO:0009733	Biological Process	response to auxin
GO:0009739	Biological Process	response to gibberellin
GO:0009751	Biological Process	response to salicylic acid
GO:0009753	Biological Process	response to jasmonic acid
GO:0009908	Biological Process	flower development
GO:0009944	Biological Process	polarity specification of adaxial/abaxial axis
GO:0010338	Biological Process	leaf formation
GO:0030154	Biological Process	cell differentiation
GO:0042742	Biological Process	defense response to bacterium
GO:0045088	Biological Process	regulation of innate immune response
GO:0045892	Biological Process	negative regulation of transcription, DNA-templated
GO:0046686	Biological Process	response to cadmium ion
GO:0050832	Biological Process	defense response to fungus
GO:0000793	Cellular Component	condensed chromosome
GO:0005730	Cellular Component	nucleolus
GO:0000981	Molecular Function	RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135	Molecular Function	transcription factor activity, RNA polymerase II transcription factor recruiting
GO:0003677	Molecular Function	DNA binding
GO:0042803	Molecular Function	protein homodimerization activity
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000037	anatomy	shoot apex
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0005022	anatomy	ovary wall
PO:0008019	anatomy	leaf lamina base
PO:0009005	anatomy	root
PO:0009006	anatomy	shoot system
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0009052	anatomy	flower pedicel
PO:0020030	anatomy	cotyledon
PO:0020038	anatomy	petiole
PO:0020100	anatomy	hypocotyl
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0025272	anatomy	ovary replum
PO:0025281	anatomy	pollen
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007095	developmental stage	LP.08 eight leaves visible stage
PO:0007098	developmental stage	LP.02 two leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 367 aa Download sequence Send to blast
MKERQRWSGE EDALLRAYVR QFGPREWHLV SERMNKPLNR DAKSCLERWK NYLKPGIKKG 60 SLTEEEQRLV IRLQEKHGNK WKKIAAEVPG RTAKRLGKWW EVFKEKQQRE EKESNKRVEP 120 IDESKYDRIL ESFAEKLVKE RSNVVPAAAA AATVVMANSN GGFLHSEQQV QPPNPVIPPW 180 LATSNNGNNV VARPPSVTLT LSPSTVAAAA PQPPIPWLQQ QQPERAENGP GGLVLGSMMP 240 SCSGSSESVF LSELVECCRE LEEGHRAWAD HKKEAAWRLR RLELQLESEK TCRQREKMEE 300 IEAKMKALRE EQKNAMEKIE GEYREQLVGL RRDAEAKDQK LADQWTSRHI RLTKFLEQQM 360 GCRLDRP

Sequence ? help Back to Top

Protein Sequence Length: 367 aa Download sequence Send to blast

MKERQRWSGE EDALLRAYVR QFGPREWHLV SERMNKPLNR DAKSCLERWK NYLKPGIKKG  60
SLTEEEQRLV IRLQEKHGNK WKKIAAEVPG RTAKRLGKWW EVFKEKQQRE EKESNKRVEP  120
IDESKYDRIL ESFAEKLVKE RSNVVPAAAA AATVVMANSN GGFLHSEQQV QPPNPVIPPW  180
LATSNNGNNV VARPPSVTLT LSPSTVAAAA PQPPIPWLQQ QQPERAENGP GGLVLGSMMP  240
SCSGSSESVF LSELVECCRE LEEGHRAWAD HKKEAAWRLR RLELQLESEK TCRQREKMEE  300
IEAKMKALRE EQKNAMEKIE GEYREQLVGL RRDAEAKDQK LADQWTSRHI RLTKFLEQQM  360
GCRLDRP

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1gv2_A	4e-15	7	92	7	89	MYB PROTO-ONCOGENE PROTEIN
1mse_C	4e-15	7	92	7	89	C-Myb DNA-Binding Domain
1msf_C	4e-15	7	92	7	89	C-Myb DNA-Binding Domain
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.11577	0.0	flower\| leaf\| seed

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	145360723	0.0
Genevisible	267157_at	0.0
Expression Atlas	AT2G37630	-
AtGenExpress	AT2G37630	-
ATTED-II	AT2G37630	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Preferential expression in young and immature plant tissues. In embryos, expressed from the late globular stage onwards. After germination, detected in leaf founder cells and on flowering, in primordia of all floral organs.
Uniprot	TISSUE SPECIFICITY: Expressed in roots, stems, leaves, flowers, siliques and in lateral organ promordia (PubMed:17559509). Found in the inner domain between the adaxial and abaxial domains of leaves (PubMed:17559509). Expressed in the phloem tissues of leaves, cotyledons, hypocotyls, and roots (PubMed:21950734). {ECO:0000269\|PubMed:17559509, ECO:0000269\|PubMed:21950734}.

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes a MYB-domain protein involved in specification of the leaf proximodistal axis. Mutation results in lobed and dissected leaves with a characteristic asymmetry. Homologous to the Antirrhinum PHANTASTICA (PHAN) and maize ROUGH SHEATH2 (RS2) genes Asymmetric placement of auxin response at the distal leaf tip precedes visible asymmetric leaf growth. Acts alongside AXR1 to exclude BP expression in leaves and with PIN1 to repress BP and promote lateral organ growth. Interacts physically with AS2 to form a complex that binds to the BP promoter and silences BP. Also functions as a regulator of the plant immune response.
UniProt	Transcription factor required for normal cell differentiation. Positively regulates LATERAL ORGAN BOUNDARIES (LOB) within the shoot apex, and the class III HD-ZIP genes REV, PHB, and PHV. Interacts directly with ASYMMETRIC LEAVES 2 (LBD6/AS2) to repress the knox homeobox genes BP/KNAT1, KNAT2, and KNAT6 and the abaxial determinants ARF3/ETT, KAN2 and YAB5. May act in parallel with the RDR6-SGS3-AGO7 pathway, an endogenous RNA silencing pathway, to regulate the leaf morphogenesis (PubMed:11076771, PubMed:11140682, PubMed:11882937, PubMed:12750468, PubMed:16006579, PubMed:16699177, PubMed:17395603, PubMed:17559509, PubMed:23271976). Binds directly to KNAT1, KNAT2, and KNATM chromatin, regulating leaf development (PubMed:23271976). LBD6 is required for this binding (PubMed:23271976). Positive regulator of flowering that binds to the promoter of FT (PubMed:21950734). Regulates FT expression by forming a functional complex with CO (PubMed:21950734). Involved in leaf polarity establishment by functioning cooperatively with NUCL1 to repress abaxial genes ARF3, ARF4, KAN1, KAN2, YAB1 and YAB5, and the knox homeobox genes KNAT1, KNAT2, KNAT6, and STM to promote adaxial development in leaf primordia at shoot apical meristems at high temperatures (PubMed:27334696). {ECO:0000269\|PubMed:11076771, ECO:0000269\|PubMed:11140682, ECO:0000269\|PubMed:11882937, ECO:0000269\|PubMed:12750468, ECO:0000269\|PubMed:16006579, ECO:0000269\|PubMed:16699177, ECO:0000269\|PubMed:17395603, ECO:0000269\|PubMed:17559509, ECO:0000269\|PubMed:23271976, ECO:0000269\|PubMed:27334696}.

Function -- GeneRIF ? help Back to Top
Our data suggest that RS2/AS1 and HIRA mediate the epigenetic silencing of knox genes, possibly by modulating chromatin structure. [PMID: 16243907] RDR6, SGS3 and AGO7 act in the same pathway, which genetically interacts with the AS1-AS2 pathway for leaf development. [PMID: 16699177] AS1 patterns the Arabidopsis gynoecium by repressing BP. [PMID: 17592013] function of AS1 in responses to phytopathogens is independent of its AS2-associated role in development [PMID: 18003921] A previously unrecognized fundamental regulation by which AS1, AS2, and JAG act to define sepal and petal from their boundaries is reported. [PMID: 18156293] AS1 and AS2 form a repressor complex that binds directly to the regulatory motifs CWGTTD and KMKTTGAHW present at two sites in the promoters of the KNOX genes BREVIPEDICELLUS (BP) and KNAT2. [PMID: 18203921] results of studying new alleles of AS1 and AS2 support their role in control of class I KNOX genes and auxin transport. [PMID: 18409376] AS1, AS2 and the AS1-AS2 protein complex may have distinct functions, which are all required for normal plant development. [PMID: 18713400] Results revealed that the reduction in leaf size and late flowering were caused by the repression, by KNOX genes, of a gibberellin (GA) pathway in as1 and as2 plants. [PMID: 19891706] Data show that TCP3 directly activates the expression of genes for miR164, ASYMMETRIC LEAVES1 (AS1), INDOLE-3-ACETIC ACID3/SHORT HYPOCOTYL2 (IAA3/SHY2), and SMALL AUXIN UP RNA (SAUR) proteins. [PMID: 21119060] CONSTANS (CO) forms a functional complex with ASYMMETRIC LEAVES 1 (AS1) to regulate FLOWERING LOCUS T (FT) expression and that AS1 plays different roles in two regulatory pathways, both of which concomitantly regulate the precise timing of flowering. [PMID: 21950734] AS1 transcriptional control of meristem cell-specific genes is inhibited by Calmodulin. [PMID: 22554014] In combination with mutations in the MYB domain transcription factor gene ASYMMETRIC LEAVES1 (AS1), partial loss of EMBRYO DEFECTIVE DEVELOPMENT1 (EDD1) function results in leaves with reduced adaxial fate. [PMID: 22791832] The JLO and AS2 proteins interact molecularly and form multimeric complexes with AS1 to suppress KNOX expression. AS2 together with JLO regulate auxin transport in seedling roots. [PMID: 22822207] Taken together, these data indicate that HDA6 is a part of the AS1 repressor complex to regulate the KNOX expression in leaf development. [PMID: 23271976] Negative transcriptional, post-transcriptional and epigenetic regulation of ARF3 by AS1-AS2 is important for stabilizing early leaf partitioning into abaxial and adaxial domains. [PMID: 23571218] critical for the proper placement of the floral organ abscission zones, and influences the timing of organ shedding [PMID: 25038814] that complexes of the transcription factors ASYMMETRIC LEAVES 1 (AS1) and AS2 could help to establish the H3K27me3 modification at the chromatin regions of Class-I KNOTTED1-like homeobox (KNOX) genes BREVIPEDICELLUS and KNAT2 via direct interactions with LHP1. [PMID: 27273574]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT2G37630.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian-regulation with an afternoon peak in long days and with a broad night peak in short days (PubMed:21950734). Expression of AS1 in stem cells of the shoot apical meristem is prevented by SHOOT MERISTEMLESS (STM). Expression is activated by GTE6 during leaf morphogenesis (PubMed:16166385). {ECO:0000269\|PubMed:16166385, ECO:0000269\|PubMed:21950734}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source	Upstream Regulator (A: Activate/R: Repress)
ATRM	AT1G53230 (A), AT1G55580 (A), AT1G62360 (R), AT4G00220 (R), AT5G23000 (A)

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT1G23380(R), AT1G32240(R), AT1G70510(R), AT2G26580(R), AT2G33860(R), AT2G34710(A), AT2G45190(R), AT3G15170(R), AT4G08150(R), AT5G03680(R), AT5G53950(R), AT5G63090(A)

Regulation -- Hormone ? help Back to Top
Source	Hormone
AHD	auxin, gibberellin, Gibberellin, jasmonic acid, salicylic acid

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT2G37630, AT4G36870, AT5G15840, AT5G63090, AT1G65620
IntAct	Search O80931

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT2G37630

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC004684	0.0	AC004684.3 Arabidopsis thaliana chromosome 2 clone F13M22 map ve018, complete sequence.
GenBank	AF175996	0.0	AF175996.1 Arabidopsis thaliana putative transcription factor (MYB91) mRNA, complete cds.
GenBank	AY519578	0.0	AY519578.1 Arabidopsis thaliana MYB transcription factor (At2g37630) mRNA, complete cds.
GenBank	BT026027	0.0	BT026027.1 Arabidopsis thaliana At2g37630 mRNA, complete cds.
GenBank	CP002685	0.0	CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_181299.1	0.0	myb-like HTH transcriptional regulator family protein
Swissprot	O80931	0.0	AS1_ARATH; Transcription factor AS1
TrEMBL	A0A178W165	0.0	A0A178W165_ARATH; MYB91
STRING	AT2G37630.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM6186	27	40
Representative plant	OGRP5096	14	21

Link Out ? help Back to Top
Phytozome	AT2G37630.1
Entrez Gene	818340
iHOP	AT2G37630
wikigenes	AT2G37630

Publications ? help Back to Top
Timmermans MC,Hudson A,Becraft PW,Nelson T ROUGH SHEATH2: a Myb protein that represses knox homeobox genes in maize lateral organ primordia. Science, 1999. 284(5411): p. 151-3 [PMID:10102816] Ori N,Eshed Y,Chuck G,Bowman JL,Hake S Mechanisms that control knox gene expression in the Arabidopsis shoot. Development, 2000. 127(24): p. 5523-32 [PMID:11076771] Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Byrne ME, et al. Asymmetric leaves1 mediates leaf patterning and stem cell function in Arabidopsis. Nature, 2000 Dec 21-28. 408(6815): p. 967-71 [PMID:11140682] Tsiantis M Control of shoot cell fate: beyond homeoboxes. Plant Cell, 2001. 13(4): p. 733-8 [PMID:11283332] J Apical-basal pattern formation in Arabidopsis embryogenesis. EMBO J., 2001. 20(14): p. 3609-16 [PMID:11447101] Stracke R,Werber M,Weisshaar B The R2R3-MYB gene family in Arabidopsis thaliana. Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56 [PMID:11597504] Sun Y,Zhou Q,Zhang W,Fu Y,Huang H ASYMMETRIC LEAVES1, an Arabidopsis gene that is involved in the control of cell differentiation in leaves. Planta, 2002. 214(5): p. 694-702 [PMID:11882937] Venglat SP, et al. The homeobox gene BREVIPEDICELLUS is a key regulator of inflorescence architecture in Arabidopsis. Proc. Natl. Acad. Sci. U.S.A., 2002. 99(7): p. 4730-5 [PMID:11917137] Byrne ME,Simorowski J,Martienssen RA ASYMMETRIC LEAVES1 reveals knox gene redundancy in Arabidopsis. Development, 2002. 129(8): p. 1957-65 [PMID:11934861] Golz JF,Hudson A Signalling in plant lateral organ development. Plant Cell, 2002. 14 Suppl: p. S277-88 [PMID:12045283] Shuai B,Reynaga-Peña CG,Springer PS The lateral organ boundaries gene defines a novel, plant-specific gene family. Plant Physiol., 2002. 129(2): p. 747-61 [PMID:12068116] Barley R,Waites R Plant meristems: the interplay of KNOX and gibberellins. Curr. Biol., 2002. 12(20): p. R696-8 [PMID:12401187] Micol JL,Hake S The development of plant leaves. Plant Physiol., 2003. 131(2): p. 389-94 [PMID:12586863] Theodoris G,Inada N,Freeling M Conservation and molecular dissection of ROUGH SHEATH2 and ASYMMETRIC LEAVES1 function in leaf development. Proc. Natl. Acad. Sci. U.S.A., 2003. 100(11): p. 6837-42 [PMID:12750468] Xu L, et al. Novel as1 and as2 defects in leaf adaxial-abaxial polarity reveal the requirement for ASYMMETRIC LEAVES1 and 2 and ERECTA functions in specifying leaf adaxial identity. Development, 2003. 130(17): p. 4097-107 [PMID:12874130] Kim M,McCormick S,Timmermans M,Sinha N The expression domain of PHANTASTICA determines leaflet placement in compound leaves. Nature, 2003. 424(6947): p. 438-43 [PMID:12879073] Lin WC,Shuai B,Springer PS The Arabidopsis LATERAL ORGAN BOUNDARIES-domain gene ASYMMETRIC LEAVES2 functions in the repression of KNOX gene expression and in adaxial-abaxial patterning. Plant Cell, 2003. 15(10): p. 2241-52 [PMID:14508003] Hibara K,Takada S,Tasaka M CUC1 gene activates the expression of SAM-related genes to induce adventitious shoot formation. Plant J., 2003. 36(5): p. 687-96 [PMID:14617069] Katz A,Oliva M,Mosquna A,Hakim O,Ohad N FIE and CURLY LEAF polycomb proteins interact in the regulation of homeobox gene expression during sporophyte development. Plant J., 2004. 37(5): p. 707-19 [PMID:14871310] McHale NA,Koning RE PHANTASTICA regulates development of the adaxial mesophyll in Nicotiana leaves. Plant Cell, 2004. 16(5): p. 1251-62 [PMID:15084717] Mallory AC,Dugas DV,Bartel DP,Bartel B MicroRNA regulation of NAC-domain targets is required for proper formation and separation of adjacent embryonic, vegetative, and floral organs. Curr. Biol., 2004. 14(12): p. 1035-46 [PMID:15202996] Engstrom EM,Izhaki A,Bowman JL Promoter bashing, microRNAs, and Knox genes. New insights, regulators, and targets-of-regulation in the establishment of lateral organ polarity in Arabidopsis. Plant Physiol., 2004. 135(2): p. 685-94 [PMID:15208415] Schrader J, et al. A high-resolution transcript profile across the wood-forming meristem of poplar identifies potential regulators of cambial stem cell identity. Plant Cell, 2004. 16(9): p. 2278-92 [PMID:15316113] Zgurski JM,Sharma R,Bolokoski DA,Schultz EA Asymmetric auxin response precedes asymmetric growth and differentiation of asymmetric leaf1 and asymmetric leaf2 Arabidopsis leaves. Plant Cell, 2005. 17(1): p. 77-91 [PMID:15608337] Tattersall AD, et al. The mutant crispa reveals multiple roles for PHANTASTICA in pea compound leaf development. Plant Cell, 2005. 17(4): p. 1046-60 [PMID:15749758] Kwon CS,Chen C,Wagner D WUSCHEL is a primary target for transcriptional regulation by SPLAYED in dynamic control of stem cell fate in Arabidopsis. Genes Dev., 2005. 19(8): p. 992-1003 [PMID:15833920] Kidner CA,Martienssen RA The role of ARGONAUTE1 (AGO1) in meristem formation and identity. Dev. Biol., 2005. 280(2): p. 504-17 [PMID:15882589] Hazen SP, et al. Rapid array mapping of circadian clock and developmental mutations in Arabidopsis. Plant Physiol., 2005. 138(2): p. 990-7 [PMID:15908595] Li H, et al. The Putative RNA-dependent RNA polymerase RDR6 acts synergistically with ASYMMETRIC LEAVES1 and 2 to repress BREVIPEDICELLUS and MicroRNA165/166 in Arabidopsis leaf development. Plant Cell, 2005. 17(8): p. 2157-71 [PMID:16006579] Chua YL,Channeli The bromodomain protein GTE6 controls leaf development in Arabidopsis by histone acetylation at ASYMMETRIC LEAVES1. Genes Dev., 2005. 19(18): p. 2245-54 [PMID:16166385] Phelps-Durr TL,Thomas J,Vahab P,Timmermans MC Maize rough sheath2 and its Arabidopsis orthologue ASYMMETRIC LEAVES1 interact with HIRA, a predicted histone chaperone, to maintain knox gene silencing and determinacy during organogenesis. Plant Cell, 2005. 17(11): p. 2886-98 [PMID:16243907] Yanhui C, et al. The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. Plant Mol. Biol., 2006. 60(1): p. 107-24 [PMID:16463103] Keller T,Abbott J,Moritz T,Doerner P Arabidopsis REGULATOR OF AXILLARY MERISTEMS1 controls a leaf axil stem cell niche and modulates vegetative development. Plant Cell, 2006. 18(3): p. 598-611 [PMID:16473968] Garcia D,Collier SA,Byrne ME,Martienssen RA Specification of leaf polarity in Arabidopsis via the trans-acting siRNA pathway. Curr. Biol., 2006. 16(9): p. 933-8 [PMID:16682355] Xu L, et al. Genetic interaction between the AS1-AS2 and RDR6-SGS3-AGO7 pathways for leaf morphogenesis. Plant Cell Physiol., 2006. 47(7): p. 853-63 [PMID:16699177] Hay A,Barkoulas M,Tsiantis M ASYMMETRIC LEAVES1 and auxin activities converge to repress BREVIPEDICELLUS expression and promote leaf development in Arabidopsis. Development, 2006. 133(20): p. 3955-61 [PMID:16971475] Huang W, et al. The proteolytic function of the Arabidopsis 26S proteasome is required for specifying leaf adaxial identity. Plant Cell, 2006. 18(10): p. 2479-92 [PMID:17028202] Okushima Y,Fukaki H,Onoda M,Theologis A,Tasaka M ARF7 and ARF19 regulate lateral root formation via direct activation of LBD/ASL genes in Arabidopsis. Plant Cell, 2007. 19(1): p. 118-30 [PMID:17259263] Ueno Y, et al. Histone deacetylases and ASYMMETRIC LEAVES2 are involved in the establishment of polarity in leaves of Arabidopsis. Plant Cell, 2007. 19(2): p. 445-57 [PMID:17293570] Fu Y, et al. Genetic interactions between leaf polarity-controlling genes and ASYMMETRIC LEAVES1 and 2 in Arabidopsis leaf patterning. Plant Cell Physiol., 2007. 48(5): p. 724-35 [PMID:17395603] Borghi L,Bureau M,Simon R Arabidopsis JAGGED LATERAL ORGANS is expressed in boundaries and coordinates KNOX and PIN activity. Plant Cell, 2007. 19(6): p. 1795-808 [PMID:17557810] Iwakawa H, et al. Expression of the ASYMMETRIC LEAVES2 gene in the adaxial domain of Arabidopsis leaves represses cell proliferation in this domain and is critical for the development of properly expanded leaves. Plant J., 2007. 51(2): p. 173-84 [PMID:17559509] Alonso-Cantabrana H, et al. Common regulatory networks in leaf and fruit patterning revealed by mutations in the Arabidopsis ASYMMETRIC LEAVES1 gene. Development, 2007. 134(14): p. 2663-71 [PMID:17592013] Ha CM,Jun JH,Nam HG,Fletcher JC BLADE-ON-PETIOLE 1 and 2 control Arabidopsis lateral organ fate through regulation of LOB domain and adaxial-abaxial polarity genes. Plant Cell, 2007. 19(6): p. 1809-25 [PMID:17601823] Lin Z, et al. AtCDC5 regulates the G2 to M transition of the cell cycle and is critical for the function of Arabidopsis shoot apical meristem. Cell Res., 2007. 17(9): p. 815-28 [PMID:17768399] Kumar R, et al. The Arabidopsis BEL1-LIKE HOMEODOMAIN proteins SAW1 and SAW2 act redundantly to regulate KNOX expression spatially in leaf margins. Plant Cell, 2007. 19(9): p. 2719-35 [PMID:17873098] Husbands A,Bell EM,Shuai B,Smith HM,Springer PS LATERAL ORGAN BOUNDARIES defines a new family of DNA-binding transcription factors and can interact with specific bHLH proteins. Nucleic Acids Res., 2007. 35(19): p. 6663-71 [PMID:17913740] Nurmberg PL, et al. The developmental selector AS1 is an evolutionarily conserved regulator of the plant immune response. Proc. Natl. Acad. Sci. U.S.A., 2007. 104(47): p. 18795-800 [PMID:18003921] Xu B, et al. Arabidopsis genes AS1, AS2, and JAG negatively regulate boundary-specifying genes to promote sepal and petal development. Plant Physiol., 2008. 146(2): p. 566-75 [PMID:18156293] Guo M,Thomas J,Collins G,Timmermans MC Direct repression of KNOX loci by the ASYMMETRIC LEAVES1 complex of Arabidopsis. Plant Cell, 2008. 20(1): p. 48-58 [PMID:18203921] Yao Y,Ling Q,Wang H,Huang H Ribosomal proteins promote leaf adaxial identity. Development, 2008. 135(7): p. 1325-34 [PMID:18305007] Pinon V, et al. Three PIGGYBACK genes that specifically influence leaf patterning encode ribosomal proteins. Development, 2008. 135(7): p. 1315-24 [PMID:18305008] Vu KhCh,Ondar UN,Soldatova OP [Expression of new mutant alleles of AS1 and AS2 genes controlling leaf morphogenesis in Arabidopsis thaliana] Ontogenez, 2008 Jan-Feb. 39(1): p. 8-14 [PMID:18409376] Manzano C,Abraham Z,L Identification of ubiquitinated proteins in Arabidopsis. Plant Mol. Biol., 2008. 68(1-2): p. 145-58 [PMID:18535787] Zhu Y, et al. Subcellular localizations of AS1 and AS2 suggest their common and distinct roles in plant development. J Integr Plant Biol, 2008. 50(7): p. 897-905 [PMID:18713400] Yang JY, et al. betaC1, the pathogenicity factor of TYLCCNV, interacts with AS1 to alter leaf development and suppress selective jasmonic acid responses. Genes Dev., 2008. 22(18): p. 2564-77 [PMID:18794352] Morimoto R,Nishioka E,Murai K,Takumi S Functional conservation of wheat orthologs of maize rough sheath1 and rough sheath2 genes. Plant Mol. Biol., 2009. 69(3): p. 273-85 [PMID:18974935] Soyano T,Thitamadee S,Machida Y,Chua NH ASYMMETRIC LEAVES2-LIKE19/LATERAL ORGAN BOUNDARIES DOMAIN30 and ASL20/LBD18 regulate tracheary element differentiation in Arabidopsis. Plant Cell, 2008. 20(12): p. 3359-73 [PMID:19088331] Micol JL Leaf development: time to turn over a new leaf? Curr. Opin. Plant Biol., 2009. 12(1): p. 9-16 [PMID:19109050] Takahashi H, et al. Knowledge-based fuzzy adaptive resonance theory and its application to the analysis of gene expression in plants. J. Biosci. Bioeng., 2008. 106(6): p. 587-93 [PMID:19134556] Liu Z, et al. Molecular and reverse genetic characterization of NUCLEOSOME ASSEMBLY PROTEIN1 (NAP1) genes unravels their function in transcription and nucleotide excision repair in Arabidopsis thaliana. Plant J., 2009. 59(1): p. 27-38 [PMID:19228338] Jaspers P, et al. Unequally redundant RCD1 and SRO1 mediate stress and developmental responses and interact with transcription factors. Plant J., 2009. 60(2): p. 268-79 [PMID:19548978] Graciet E, et al. The N-end rule pathway controls multiple functions during Arabidopsis shoot and leaf development. Proc. Natl. Acad. Sci. U.S.A., 2009. 106(32): p. 13618-23 [PMID:19620738] Ikezaki M, et al. Genetic networks regulated by ASYMMETRIC LEAVES1 (AS1) and AS2 in leaf development in Arabidopsis thaliana: KNOX genes control five morphological events. Plant J., 2010. 61(1): p. 70-82 [PMID:19891706] Tabata R, et al. Arabidopsis auxin response factor6 and 8 regulate jasmonic acid biosynthesis and floral organ development via repression of class 1 KNOX genes. Plant Cell Physiol., 2010. 51(1): p. 164-75 [PMID:20007966] Yun KY, et al. Transcriptional regulatory network triggered by oxidative signals configures the early response mechanisms of japonica rice to chilling stress. BMC Plant Biol., 2010. 10: p. 16 [PMID:20100339] P A role for AUXIN RESISTANT3 in the coordination of leaf growth. Plant Cell Physiol., 2010. 51(10): p. 1661-73 [PMID:20739302] Wang L, et al. miR396-targeted AtGRF transcription factors are required for coordination of cell division and differentiation during leaf development in Arabidopsis. J. Exp. Bot., 2011. 62(2): p. 761-73 [PMID:21036927] Koyama T,Mitsuda N,Seki M,Shinozaki K,Ohme-Takagi M TCP transcription factors regulate the activities of ASYMMETRIC LEAVES1 and miR164, as well as the auxin response, during differentiation of leaves in Arabidopsis. Plant Cell, 2010. 22(11): p. 3574-88 [PMID:21119060] Horiguchi G, et al. Differential contributions of ribosomal protein genes to Arabidopsis thaliana leaf development. Plant J., 2011. 65(5): p. 724-36 [PMID:21251100] Song YH,Lee I,Lee SY,Imaizumi T,Hong JC CONSTANS and ASYMMETRIC LEAVES 1 complex is involved in the induction of FLOWERING LOCUS T in photoperiodic flowering in Arabidopsis. Plant J., 2012. 69(2): p. 332-42 [PMID:21950734] Causier B,Ashworth M,Guo W,Davies B The TOPLESS interactome: a framework for gene repression in Arabidopsis. Plant Physiol., 2012. 158(1): p. 423-38 [PMID:22065421] Li Z,Li B,Shen WH,Huang H,Dong A TCP transcription factors interact with AS2 in the repression of class-I KNOX genes in Arabidopsis thaliana. Plant J., 2012. 71(1): p. 99-107 [PMID:22380849] Han HJ, et al. The transcriptional repressor activity of ASYMMETRIC LEAVES1 is inhibited by direct interaction with calmodulin in Arabidopsis. Plant Cell Environ., 2012. 35(11): p. 1969-82 [PMID:22554014] Nakagawa A, et al. Berberine enhances defects in the establishment of leaf polarity in asymmetric leaves1 and asymmetric leaves2 of Arabidopsis thaliana. Plant Mol. Biol., 2012. 79(6): p. 569-81 [PMID:22684430] Moschopoulos A,Derbyshire P,Byrne ME The Arabidopsis organelle-localized glycyl-tRNA synthetase encoded by EMBRYO DEFECTIVE DEVELOPMENT1 is required for organ patterning. J. Exp. Bot., 2012. 63(14): p. 5233-43 [PMID:22791832] Rast MI,Simon R Arabidopsis JAGGED LATERAL ORGANS acts with ASYMMETRIC LEAVES2 to coordinate KNOX and PIN expression in shoot and root meristems. Plant Cell, 2012. 24(7): p. 2917-33 [PMID:22822207] Mecchia MA,Debernardi JM,Rodriguez RE,Schommer C,Palatnik JF MicroRNA miR396 and RDR6 synergistically regulate leaf development. Mech. Dev., 2013. 130(1): p. 2-13 [PMID:22889666] Bonaccorso O,Lee JE,Puah L,Scutt CP,Golz JF FILAMENTOUS FLOWER controls lateral organ development by acting as both an activator and a repressor. BMC Plant Biol., 2012. 12: p. 176 [PMID:23025792] Gonz Antagonistic gene activities determine the formation of pattern elements along the mediolateral axis of the Arabidopsis fruit. PLoS Genet., 2012. 8(11): p. e1003020 [PMID:23133401] Ishibashi N, et al. ASYMMETRIC-LEAVES2 and an ortholog of eukaryotic NudC domain proteins repress expression of AUXIN-RESPONSE-FACTOR and class 1 KNOX homeobox genes for development of flat symmetric leaves in Arabidopsis. Biol Open, 2012. 1(3): p. 197-207 [PMID:23213410] Luo M, et al. Histone deacetylase HDA6 is functionally associated with AS1 in repression of KNOX genes in arabidopsis. PLoS Genet., 2012. 8(12): p. e1003114 [PMID:23271976] Takahashi H, et al. Meta-analyses of microarrays of Arabidopsis asymmetric leaves1 (as1), as2 and their modifying mutants reveal a critical role for the ETT pathway in stabilization of adaxial-abaxial patterning and cell division during leaf development. Plant Cell Physiol., 2013. 54(3): p. 418-31 [PMID:23396601] Efroni I, et al. Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses. Dev. Cell, 2013. 24(4): p. 438-45 [PMID:23449474] Lodha M,Marco CF,Timmermans MC The ASYMMETRIC LEAVES complex maintains repression of KNOX homeobox genes via direct recruitment of Polycomb-repressive complex2. Genes Dev., 2013. 27(6): p. 596-601 [PMID:23468429] Iwasaki M, et al. Dual regulation of ETTIN (ARF3) gene expression by AS1-AS2, which maintains the DNA methylation level, is involved in stabilization of leaf adaxial-abaxial partitioning in Arabidopsis. Development, 2013. 140(9): p. 1958-69 [PMID:23571218] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Zhou F,Roy B,Dunlap JR,Enganti R,von Arnim AG Translational control of Arabidopsis meristem stability and organogenesis by the eukaryotic translation factor eIF3h. PLoS ONE, 2014. 9(4): p. e95396 [PMID:24736281] Scofield S,Dewitte W,Murray JA STM sustains stem cell function in the Arabidopsis shoot apical meristem and controls KNOX gene expression independently of the transcriptional repressor AS1. Plant Signal Behav, 2018. [PMID:24776954] Ivanova A, et al. A Functional Antagonistic Relationship between Auxin and Mitochondrial Retrograde Signaling Regulates Alternative Oxidase1a Expression in Arabidopsis. Plant Physiol., 2014. 165(3): p. 1233-1254 [PMID:24820025] Gubert CM,Christy ME,Ward DL,Groner WD,Liljegren SJ ASYMMETRIC LEAVES1 regulates abscission zone placement in Arabidopsis flowers. BMC Plant Biol., 2014. 14: p. 195 [PMID:25038814] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis. Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71 [PMID:26108442] Kaurilind E,Xu E,Brosché M A genetic framework for H2O2 induced cell death in Arabidopsis thaliana. BMC Genomics, 2015. 16: p. 837 [PMID:26493993] Mateo-Bonmatí E, et al. Plastid control of abaxial-adaxial patterning. Sci Rep, 2015. 5: p. 15975 [PMID:26522839] Rast-Somssich MI, et al. Alternate wiring of a KNOXI genetic network underlies differences in leaf development of A. thaliana and C. hirsuta. Genes Dev., 2015. 29(22): p. 2391-404 [PMID:26588991] Guzmán-López JA,Abraham-Juárez MJ,Lozano-Sotomayor P,de Folter S,Simpson J Arabidopsis thaliana gonidialess A/Zuotin related factors (GlsA/ZRF) are essential for maintenance of meristem integrity. Plant Mol. Biol., 2016. 91(1-2): p. 37-51 [PMID:26826012] Li Z, et al. Transcription factors AS1 and AS2 interact with LHP1 to repress KNOX genes in Arabidopsis. J Integr Plant Biol, 2016. 58(12): p. 959-970 [PMID:27273574] Matsumura Y, et al. A genetic link between epigenetic repressor AS1-AS2 and a putative small subunit processome in leaf polarity establishment of Arabidopsis. Biol Open, 2016. 5(7): p. 942-54 [PMID:27334696] Silverblatt-Buser EW,Frick MA,Rabeler C,Kaplinsky NJ Genetic Interactions Between BOB1 and Multiple 26S Proteasome Subunits Suggest a Role for Proteostasis in Regulating Arabidopsis Development. G3 (Bethesda), 2018. 8(4): p. 1379-1390 [PMID:29487187] Tsukaya H,Uchimiya H Genetic analyses of the formation of the serrated margin of leaf blades in Arabidopsis: combination of a mutational analysis of leaf morphogenesis with the characterization of a specific marker gene expressed in hydathodes and stipules. Mol. Gen. Genet., 1997. 256(3): p. 231-8 [PMID:9393447] Kranz HD, et al. Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana. Plant J., 1998. 16(2): p. 263-76 [PMID:9839469]