PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pavir.1KG175300.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 184aa MW: 19797.4 Da PI: 8.519 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 34.4 | 4.8e-11 | 55 | 98 | 5 | 48 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 kr +r NR +A+rsR RK+++i eLe+ v +L+ e + L + Pavir.1KG175300.1.p 55 KRVKRILANRQSAQRSRVRKLQYISELERSVTSLQMEVSVLSPR 98 899*******************************9997776655 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 1.2E-12 | 51 | 115 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 9.496 | 53 | 109 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 1.2E-11 | 55 | 109 | No hit | No description |
Pfam | PF00170 | 2.5E-9 | 55 | 102 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 1.3E-13 | 55 | 109 | No hit | No description |
CDD | cd14703 | 1.94E-20 | 56 | 106 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 58 | 73 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 184 aa Download sequence Send to blast |
MSMFSDVDAP AVSDGAGGER AGDAQLMDMG DAEDEMAASS PAGARAAADG VADPKRVKRI 60 LANRQSAQRS RVRKLQYISE LERSVTSLQM EVSVLSPRVA FLDHQRSLLT VGNSHLKQRI 120 AALAQDKIFK DAHQEALKKE IERLRQLFHQ QQIKATTGGA DIATAASMQA RQELLACEGA 180 AIR* |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Pvr.21048 | 0.0 | root| stem |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots and shoots. {ECO:0000269|PubMed:18065552}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription regulator. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pavir.1KG175300.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By white light. {ECO:0000269|PubMed:18065552}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FP096247 | 1e-147 | FP096247.1 Phyllostachys edulis cDNA clone: bphyst038a13, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025828193.1 | 1e-124 | basic leucine zipper 19-like | ||||
Swissprot | Q6K3R9 | 2e-92 | BZP19_ORYSJ; Basic leucine zipper 19 | ||||
TrEMBL | A0A2T7F478 | 1e-124 | A0A2T7F478_9POAL; Uncharacterized protein | ||||
STRING | Pavir.Ab01112.1.p | 1e-122 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1322 | 38 | 125 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G58120.1 | 4e-57 | bZIP family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pavir.1KG175300.1.p |