PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Potri.T105400.1

Common Name

POPTR_0017s02220g

Organism

Populus trichocarpa

Taxonomic ID

3694

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus

Family

G2-like

Protein Properties

Length: 180aa MW: 19544.3 Da PI: 5.5295

Description

G2-like family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Potri.T105400.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	G2-like	72	8.5e-23	1	41	15	55
G2-like 15 veaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 v+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+ Potri.T105400.1 1 VHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 41 89**************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	6.8E-19	1	41	IPR009057	Homeodomain-like
SuperFamily	SSF46689	7.35E-8	1	42	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	5.9E-16	1	41	IPR006447	Myb domain, plants

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 180 aa Download sequence Send to blast
VHAVELLGGH ERATPKSVLE LMDVKDLTLA HVKSHLQMYR TVKTTDKPAA SSDGSGEEDM 60 APIASFRTAN EQGGLQRAVQ ADGSTAQQDM DYPSTTTSAA TTLWSNSSSG REAWPQTNSN 120 DIDGHRQGTF QSQQRSGHQM EECNSTQLKS YLGSSNMDCK NPSLEFTLGR PDWQGKEHC*

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: In globular embryos, expressed in the peripheral cells in a basal region above the hypophysis. In heart-stage embryos, expressed in the periphery of the presumptive hypocotyl and on the abaxial side of cotyledon primordia. During vegetative growth, expressed the abaxial side of very young leaf primordia. Expressed on the abaxial side of carpel primordia and then in a localized region on the abaxial margin that gives rise to the septum. Later, expressed in the tissue that gives rise to ovules. {ECO:0000269\|PubMed:11525739}.
Uniprot	TISSUE SPECIFICITY: Expressed in developing phloem and lateral root. {ECO:0000269\|PubMed:11525739, ECO:0000269\|PubMed:14561401, ECO:0000269\|PubMed:15286295}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional repressor that regulates lateral organ polarity. Promotes lateral organ abaxial identity by repressing the adaxial regulator ASYMMETRIC LEAVES2 (AS2) in abaxial cells. Required for abaxial identity in both leaves and carpels. Functions with KAN2 in the specification of polarity of the ovule outer integument. Regulates cambium activity by repressing the auxin efflux carrier PIN1. Plays a role in lateral root formation and development. {ECO:0000269\|PubMed:11395775, ECO:0000269\|PubMed:11525739, ECO:0000269\|PubMed:14561401, ECO:0000269\|PubMed:15286295, ECO:0000269\|PubMed:16623911, ECO:0000269\|PubMed:17307928, ECO:0000269\|PubMed:18849474, ECO:0000269\|PubMed:20179097}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Potri.T105400.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed by AS2 in adaxial tissue. {ECO:0000269\|PubMed:18849474}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC214214	2e-86	AC214214.1 Populus trichocarpa clone POP028-A01, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024448674.1	1e-132	transcription repressor KAN1
Swissprot	Q93WJ9	6e-51	KAN1_ARATH; Transcription repressor KAN1
TrEMBL	A0A2K1X7N1	1e-125	A0A2K1X7N1_POPTR; Uncharacterized protein
STRING	POPTR_0017s02220.1	1e-127	(Populus trichocarpa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1756	33	91
Representative plant	OGRP570	15	80

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G16560.1	4e-49	G2-like family protein

Link Out ? help Back to Top
Phytozome	Potri.T105400.1
Entrez Gene	18106569

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Huang T,Kerstetter RA,Irish VF APUM23, a PUF family protein, functions in leaf development and organ polarity in Arabidopsis. J. Exp. Bot., 2014. 65(4): p. 1181-91 [PMID:24449383] Mach J Getting in Shape? Leaves work it out with KANADI1. Plant Cell, 2014. 26(1): p. 4 [PMID:24464293] Jun SE, et al. Comparative analysis of the conserved functions of Arabidopsis DRL1 and yeast KTI12. Mol. Cells, 2015. 38(3): p. 243-50 [PMID:25518926] Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis. Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71 [PMID:26108442] Xie Y, et al. Meta-Analysis of Arabidopsis KANADI1 Direct Target Genes Identifies a Basic Growth-Promoting Module Acting Upstream of Hormonal Signaling Pathways. Plant Physiol., 2015. 169(2): p. 1240-53 [PMID:26246448] Alvarez JP,Furumizu C,Efroni I,Eshed Y,Bowman JL Active suppression of a leaf meristem orchestrates determinate leaf growth. Elife, 2017. [PMID:27710768] Singh A, et al. Phytohormonal crosstalk modulates the expression of miR166/165s, target Class III HD-ZIPs, and KANADI genes during root growth in Arabidopsis thaliana. Sci Rep, 2017. 7(1): p. 3408 [PMID:28611467] Caggiano MP, et al. Cell type boundaries organize plant development. Elife, 2018. [PMID:28895530] Ó'Maoiléidigh DS,Stewart D,Zheng B,Coupland G,Wellmer F Floral homeotic proteins modulate the genetic program for leaf development to suppress trichome formation in flowers. Development, 2018. [PMID:29361563]