PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Potri.014G096300.2 | ||||||||
Common Name | POPTR_0014s09200g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 89aa MW: 10613 Da PI: 8.9342 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 27.8 | 6.1e-09 | 30 | 69 | 4 | 45 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 ++++E++l+++ +++ G + W++Ia +++ gR ++++ +w+ Potri.014G096300.2 30 MSEQEEDLIYRMHNLVGDR-WALIAGRIP-GRKAEEIERFWL 69 79***************99.*********.***********7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 2.8E-6 | 26 | 74 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.43E-5 | 29 | 70 | No hit | No description |
Pfam | PF00249 | 1.2E-8 | 30 | 70 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 4.1E-7 | 31 | 69 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 1.6E-10 | 31 | 69 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0009753 | Biological Process | response to jasmonic acid | ||||
GO:0009913 | Biological Process | epidermal cell differentiation | ||||
GO:0010063 | Biological Process | positive regulation of trichoblast fate specification | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 89 aa Download sequence Send to blast |
MDRRRKKQAK TTSCCSEQEV SSIEWEFINM SEQEEDLIYR MHNLVGDRWA LIAGRIPGRK 60 AEEIERFWLM RHGEGFASRR REQKRCHS* |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Ubiquitous in young leaves. Later, restricted to the leaf base in the trichome initiation zone. In mature leaves, confined to trichome cells. {ECO:0000269|PubMed:12356720}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, leaves, siliques and inflorescences. {ECO:0000269|PubMed:12356720}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Involved in epidermal cell fate specification. Negative regulator of trichome development, including endoreplication, by lateral inhibition involving intercellular interactions. Promotes the formation of hair developing cells (trichoblasts) in H position in root epidermis, probably by inhibiting non-hair cell (atrichoblasts) formation. {ECO:0000269|PubMed:10368181, ECO:0000269|PubMed:12356720}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Potri.014G096300.2 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negative autoregulation. Repressed by CPC. {ECO:0000269|PubMed:12356720}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002320853.1 | 2e-59 | MYB-like transcription factor ETC3 isoform X2 | ||||
Swissprot | Q8GV05 | 1e-35 | TRY_ARATH; Transcription factor TRY | ||||
TrEMBL | B9I8W0 | 5e-58 | B9I8W0_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0014s09200.1 | 8e-59 | (Populus trichocarpa) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G53200.1 | 5e-38 | MYB_related family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Potri.014G096300.2 |
Entrez Gene | 7494140 |