PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Potri.010G142900.1 | ||||||||
Common Name | POPTR_0010s15280g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 144aa MW: 16613 Da PI: 9.9623 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 30.2 | 9.9e-10 | 25 | 59 | 5 | 39 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLe 39 kr +r+++NRe+ArrsR ++++++e L ++ Le Potri.010G142900.1 25 KRRKRMISNRESARRSRMKRQKYMEDLVTEKSILE 59 9**************************88877776 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 8.7E-9 | 21 | 85 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 4.2E-8 | 23 | 105 | No hit | No description |
PROSITE profile | PS50217 | 8.783 | 23 | 61 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 6.56E-9 | 25 | 79 | No hit | No description |
Pfam | PF00170 | 3.4E-8 | 25 | 60 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14702 | 6.43E-13 | 26 | 76 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 28 | 43 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006521 | Biological Process | regulation of cellular amino acid metabolic process | ||||
GO:0009267 | Biological Process | cellular response to starvation | ||||
GO:0009617 | Biological Process | response to bacterium | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009901 | Biological Process | anther dehiscence | ||||
GO:0010182 | Biological Process | sugar mediated signaling pathway | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0071333 | Biological Process | cellular response to glucose stimulus | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 144 aa Download sequence Send to blast |
MPPSFAKAGS SGSEIDPPNA MVDEKRRKRM ISNRESARRS RMKRQKYMED LVTEKSILER 60 KIYEDNKKYA ALWQRHFALE SDNKVLTDEK LKLAEYLKNL QQVLASYNVI ESDQDLEVSD 120 RFLNPWQVHG SVKSITASGM FKV* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 38 | 43 | RSRMKR |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Potri.010G142900.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002314935.1 | 1e-102 | basic leucine zipper 1 | ||||
TrEMBL | A0A3G1CGI7 | 1e-101 | A0A3G1CGI7_POPCN; BZIP transcription factor | ||||
TrEMBL | B9HWY9 | 1e-101 | B9HWY9_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0010s15280.1 | 1e-102 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF15536 | 8 | 12 | Representative plant | OGRP13793 | 3 | 4 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G49450.1 | 3e-23 | basic leucine-zipper 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Potri.010G142900.1 |
Entrez Gene | 7485810 |