PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Potri.010G114000.1

Common Name

POPTR_0010s12420g

Organism

Populus trichocarpa

Taxonomic ID

3694

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus

Family

MYB

Protein Properties

Length: 227aa MW: 25603 Da PI: 9.1151

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Potri.010G114000.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	56.4	6.9e-18	13	60	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W++eEd++l+d+++++G g+W++ ++ g+ R++k+c++rw +yl Potri.010G114000.1 13 KGAWSKEEDQKLIDYIRKHGEGCWRSLPQAAGLLRCGKSCRLRWINYL 60 79****************************99**********97 PP
2	Myb_DNA-binding	53.4	6e-17	66	111	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++ ++E++l+++++++lG++ W++Ia +++ gRt++++k++w+++l Potri.010G114000.1 66 RGNFGEDEEDLIIKLHALLGNR-WSLIAGRLP-GRTDNEVKNYWNSHL 111 89******************.*****.**********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	4.6E-24	4	62	IPR009057	Homeodomain-like
PROSITE profile	PS51294	18.049	8	60	IPR017930	Myb domain
SuperFamily	SSF46689	8.99E-29	11	107	IPR009057	Homeodomain-like
SMART	SM00717	3.3E-14	12	62	IPR001005	SANT/Myb domain
Pfam	PF00249	2.2E-16	13	60	IPR001005	SANT/Myb domain
CDD	cd00167	6.91E-12	15	60	No hit	No description
PROSITE profile	PS51294	26.246	61	115	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	8.4E-26	63	116	IPR009057	Homeodomain-like
SMART	SM00717	4.2E-16	65	113	IPR001005	SANT/Myb domain
Pfam	PF00249	1.3E-15	66	111	IPR001005	SANT/Myb domain
CDD	cd00167	1.81E-11	68	111	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 227 aa Download sequence Send to blast
MRKPCCDKQD TNKGAWSKEE DQKLIDYIRK HGEGCWRSLP QAAGLLRCGK SCRLRWINYL 60 RPDLKRGNFG EDEEDLIIKL HALLGNRWSL IAGRLPGRTD NEVKNYWNSH LRRKLINMGI 120 DPNNHRLNQN LLRSRNPPNP AIATSSGLKI QAKQQPTKPR VDSEQTSDAG SCLEDDQCTL 180 PDLNLDLTMS IPSSSIAHVE GNQKDNESNF LRPQKIAPSS NLLLSQ*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	2e-29	10	115	24	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Widely expressed at low level. Highly expressed in siliques. Weakly expressed in seedlings, young and mature leaves, cauline leaves, stems, flower buds and roots. {ECO:0000269\|PubMed:9839469}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269\|PubMed:11080161}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Potri.010G114000.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269\|PubMed:11080161}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002315890.3	1e-166	myb-related protein 308
Swissprot	Q9SZP1	6e-80	MYB4_ARATH; Transcription repressor MYB4
TrEMBL	A0A2K1YSF2	1e-165	A0A2K1YSF2_POPTR; Uncharacterized protein
STRING	POPTR_0010s12420.1	1e-164	(Populus trichocarpa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF264	34	221
Representative plant	OGRP5	17	1784

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G38620.1	3e-82	myb domain protein 4

Link Out ? help Back to Top
Phytozome	Potri.010G114000.1
Entrez Gene	7459789

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Schenke D,Cai D,Scheel D Suppression of UV-B stress responses by flg22 is regulated at the chromatin level via histone modification. Plant Cell Environ., 2014. 37(7): p. 1716-21 [PMID:24450952] Zhou M, et al. Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] Zhang J, et al. Soybean SPX1 is an important component of the response to phosphate deficiency for phosphorus homeostasis. Plant Sci., 2016. 248: p. 82-91 [PMID:27181950] Zhou M, et al. LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275] Verma N,Burma PK Regulation of tapetum-specific A9 promoter by transcription factors AtMYB80, AtMYB1 and AtMYB4 in Arabidopsis thaliana and Nicotiana tabacum. Plant J., 2017. 92(3): p. 481-494 [PMID:28849604]