PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Potri.009G027300.2 | ||||||||
Common Name | POPTR_0009s03240g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 179aa MW: 19781.8 Da PI: 4.7589 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 50.4 | 5e-16 | 2 | 42 | 5 | 47 |
-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 T++E+ l +++++++G++ W++Iar+++ gRt++++k++w+++ Potri.009G027300.2 2 TPQEERLVLELHARWGNR-WSRIARKLP-GRTDNEIKNYWRTH 42 9*****************.*********.************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 9.7E-11 | 1 | 45 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.74E-12 | 1 | 42 | No hit | No description |
PROSITE profile | PS51294 | 23.49 | 1 | 47 | IPR017930 | Myb domain |
Pfam | PF00249 | 1.7E-14 | 2 | 42 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 7.49E-12 | 2 | 47 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 1.1E-19 | 2 | 44 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 179 aa Download sequence Send to blast |
MTPQEERLVL ELHARWGNRW SRIARKLPGR TDNEIKNYWR THTRKKAQER KSVVSPSLSS 60 SNCSSSSNIT TVNSSSPPGT GEASFYDTGG LEQVASAGKN GEAVQGGEKG YSMDDIWRDI 120 ENTIEPVCDG FSEEGCNFSY PSLASPSWEY RPDILWSISG EESKMFLPYD DGTMLLTG* |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Pth.2779 | 0.0 | stem |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Mainly expressed in leaves and seedlings, and to a lower extent, in roots, stems and inflorescences. Isoform MYB48-1, isoform MYB48-3 and isoform MYB48-4 are present in all of these organs, but isoform MYB48-2 is confined to leaves. {ECO:0000269|PubMed:16531467}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. {ECO:0000305}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Potri.009G027300.2 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By salicylic acid (SA). {ECO:0000269|PubMed:16463103}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024464921.1 | 1e-130 | transcription factor MYB48 isoform X1 | ||||
Swissprot | Q9LX82 | 6e-52 | MYB48_ARATH; Transcription factor MYB48 | ||||
TrEMBL | A0A2K1Z1S7 | 1e-129 | A0A2K1Z1S7_POPTR; MYB family protein | ||||
STRING | POPTR_0009s03240.1 | 1e-128 | (Populus trichocarpa) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G46130.2 | 2e-51 | myb domain protein 48 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Potri.009G027300.2 |
Entrez Gene | 7488139 |
Publications ? help Back to Top | |||
---|---|---|---|
|