PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Potri.007G115000.2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 213aa MW: 24067.5 Da PI: 8.2083 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 85 | 4.5e-27 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+i++++ rqvtfskRr g++KKA+ELS+LCdae+a+++fs +gklyeys+ Potri.007G115000.2 9 KKIDDTIARQVTFSKRRGGLFKKAYELSTLCDAEIALMVFSASGKLYEYSN 59 689**********************************************95 PP | |||||||
2 | K-box | 45.5 | 3.1e-16 | 93 | 171 | 21 | 99 |
K-box 21 lakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 +a L+kei + re+ ++ GedL+ L+l+eL++Le+ +e+sl ++ + K ++++i++l++ ++l een++Lr++++ Potri.007G115000.2 93 YATLNKEIAEKTRELSQVRGEDLQGLNLEELHKLEKLIETSLCRVVEEKGGKIINEINTLKNEGEQLVEENRRLRQQVM 171 788999999999****************************************************************997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 29.688 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 4.1E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 9.55E-29 | 2 | 70 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.12E-37 | 3 | 68 | No hit | No description |
PRINTS | PR00404 | 6.6E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 7.9E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.6E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.6E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 10.924 | 86 | 176 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 3.8E-13 | 93 | 170 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 213 aa Download sequence Send to blast |
MTRRKIQIKK IDDTIARQVT FSKRRGGLFK KAYELSTLCD AEIALMVFSA SGKLYEYSNS 60 SMGQVIEKRN LHPKNIDMFG QPSLELQPDG AVYATLNKEI AEKTRELSQV RGEDLQGLNL 120 EELHKLEKLI ETSLCRVVEE KGGKIINEIN TLKNEGEQLV EENRRLRQQV MNLSAGQRHL 180 LEPDKSSDSL VTNTRSMSSV DPFLTLGLPF RD* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6bz1_A | 3e-20 | 1 | 68 | 1 | 68 | MEF2 CHIMERA |
6bz1_B | 3e-20 | 1 | 68 | 1 | 68 | MEF2 CHIMERA |
6bz1_C | 3e-20 | 1 | 68 | 1 | 68 | MEF2 CHIMERA |
6bz1_D | 3e-20 | 1 | 68 | 1 | 68 | MEF2 CHIMERA |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Widely expressed with highest levels in shoot tips and axillary buds. Also found in fully developed pedicels and flowers. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Putative transcription factor that coordinates gene expression underlying the differentiation of the pedicel abscission zone. May also be involved in the maintenance of the inflorescence meristem state. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Potri.007G115000.2 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024461636.1 | 1e-155 | MADS-box protein JOINTLESS isoform X2 | ||||
Swissprot | Q9FUY6 | 6e-70 | JOIN_SOLLC; MADS-box protein JOINTLESS | ||||
TrEMBL | A0A2K1ZSW7 | 1e-154 | A0A2K1ZSW7_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0007s03300.1 | 1e-101 | (Populus trichocarpa) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G22540.1 | 1e-58 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Potri.007G115000.2 |
Publications ? help Back to Top | |||
---|---|---|---|
|