PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Potri.006G277800.6 | ||||||||
Common Name | POPTR_0006s29250g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 301aa MW: 32456.8 Da PI: 5.9638 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 53.6 | 5e-17 | 131 | 183 | 3 | 55 |
XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 ++kr rr+ +NRe+ArrsR+RK+a + Le v+ +++eN +L k+l+ +++ Potri.006G277800.6 131 DIKRIRRMVSNRESARRSRKRKQAHLSDLEVQVDHMTGENASLFKQLSDATQQ 183 68*****************************************9888776665 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 7.5E-17 | 129 | 193 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.806 | 131 | 194 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 4.34E-13 | 132 | 184 | No hit | No description |
Pfam | PF00170 | 7.0E-15 | 132 | 183 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 1.2E-13 | 133 | 185 | No hit | No description |
CDD | cd14702 | 5.98E-21 | 134 | 185 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 136 | 151 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0071333 | Biological Process | cellular response to glucose stimulus | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0042803 | Molecular Function | protein homodimerization activity | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 301 aa Download sequence Send to blast |
MEEQKAGGSD GMKKSESELA DFSAEIYGFF SDIFSGDLSS FPVNKTRDIV NGFSTCGGLT 60 ESCFLWSQNT NPKNSSVSVS TDAQSSLCVG SPMSANKPRV KDSQTRVAAS VSSPDQSDED 120 GLSEQSTNPH DIKRIRRMVS NRESARRSRK RKQAHLSDLE VQVDHMTGEN ASLFKQLSDA 180 TQQFRTAETN RRVLNSDVEA LRAKVKLAED MVARGSLTCN NLNQFLQSHL TSPQLLNNHN 240 LHLMPNVSPT ITIQGDEAYA GMSVSGQNSG LGLGSADISN GNLNNGILSD AASCITNIWS 300 * |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 145 | 151 | RRSRKRK |
2 | 145 | 152 | RRSRKRKQ |
3 | 147 | 152 | SRKRKQ |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Pth.11088 | 0.0 | stem |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Potri.006G277800.6 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | GU275060 | 4e-67 | GU275060.1 Populus balsamifera isolate GIL14 haplotype A G/HBF1-related bZIP protein gene, partial sequence. | |||
GenBank | GU275061 | 4e-67 | GU275061.1 Populus balsamifera isolate GIL14 haplotype B G/HBF1-related bZIP protein gene, partial sequence. | |||
GenBank | GU275062 | 4e-67 | GU275062.1 Populus balsamifera isolate HAY07 haplotype A G/HBF1-related bZIP protein gene, partial sequence. | |||
GenBank | GU275063 | 4e-67 | GU275063.1 Populus balsamifera isolate HAY07 haplotype B G/HBF1-related bZIP protein gene, partial sequence. | |||
GenBank | GU275064 | 4e-67 | GU275064.1 Populus balsamifera isolate INU03 haplotype A G/HBF1-related bZIP protein gene, partial sequence. | |||
GenBank | GU275065 | 4e-67 | GU275065.1 Populus balsamifera isolate INU03 haplotype B G/HBF1-related bZIP protein gene, partial sequence. | |||
GenBank | GU275066 | 4e-67 | GU275066.1 Populus balsamifera isolate KUU07 haplotype A G/HBF1-related bZIP protein gene, partial sequence. | |||
GenBank | GU275067 | 4e-67 | GU275067.1 Populus balsamifera isolate KUU07 haplotype B G/HBF1-related bZIP protein gene, partial sequence. | |||
GenBank | GU275068 | 4e-67 | GU275068.1 Populus balsamifera isolate LOV02 haplotype A G/HBF1-related bZIP protein gene, partial sequence. | |||
GenBank | GU275069 | 4e-67 | GU275069.1 Populus balsamifera isolate LOV02 haplotype B G/HBF1-related bZIP protein gene, partial sequence. | |||
GenBank | GU275070 | 4e-67 | GU275070.1 Populus balsamifera isolate MGR10 haplotype A G/HBF1-related bZIP protein gene, partial sequence. | |||
GenBank | GU275071 | 4e-67 | GU275071.1 Populus balsamifera isolate MGR10 haplotype B G/HBF1-related bZIP protein gene, partial sequence. | |||
GenBank | GU275072 | 4e-67 | GU275072.1 Populus balsamifera isolate NWL07 haplotype A G/HBF1-related bZIP protein gene, partial sequence. | |||
GenBank | GU275073 | 4e-67 | GU275073.1 Populus balsamifera isolate NWL07 haplotype B G/HBF1-related bZIP protein gene, partial sequence. | |||
GenBank | GU275074 | 4e-67 | GU275074.1 Populus balsamifera isolate POR11 haplotype A G/HBF1-related bZIP protein gene, partial sequence. | |||
GenBank | GU275075 | 4e-67 | GU275075.1 Populus balsamifera isolate POR11 haplotype B G/HBF1-related bZIP protein gene, partial sequence. | |||
GenBank | GU275076 | 4e-67 | GU275076.1 Populus balsamifera isolate RNA13 haplotype A G/HBF1-related bZIP protein gene, partial sequence. | |||
GenBank | GU275077 | 4e-67 | GU275077.1 Populus balsamifera isolate RNA13 haplotype B G/HBF1-related bZIP protein gene, partial sequence. | |||
GenBank | GU275078 | 4e-67 | GU275078.1 Populus balsamifera isolate WHR03 haplotype A G/HBF1-related bZIP protein gene, partial sequence. | |||
GenBank | GU275079 | 4e-67 | GU275079.1 Populus balsamifera isolate WHR03 haplotype B G/HBF1-related bZIP protein gene, partial sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006382195.1 | 0.0 | basic leucine zipper 9 | ||||
TrEMBL | U5GEY1 | 0.0 | U5GEY1_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0006s29250.1 | 0.0 | (Populus trichocarpa) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G24800.1 | 8e-73 | basic leucine zipper 9 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Potri.006G277800.6 |
Entrez Gene | 18100783 |