PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Potri.006G277800.1 | ||||||||
Common Name | POPTR_0006s29250g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 221aa MW: 24236.8 Da PI: 7.4453 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 54.2 | 3.1e-17 | 131 | 183 | 3 | 55 |
XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 ++kr rr+ +NRe+ArrsR+RK+a + Le v+ +++eN +L k+l+ +++ Potri.006G277800.1 131 DIKRIRRMVSNRESARRSRKRKQAHLSDLEVQVDHMTGENASLFKQLSDATQQ 183 68*****************************************9888776665 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 7.5E-17 | 129 | 193 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.806 | 131 | 194 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 4.5E-15 | 132 | 183 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 2.81E-13 | 132 | 184 | No hit | No description |
Gene3D | G3DSA:1.20.5.170 | 4.9E-14 | 133 | 185 | No hit | No description |
CDD | cd14702 | 3.17E-19 | 134 | 185 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 136 | 151 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0071333 | Biological Process | cellular response to glucose stimulus | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0042803 | Molecular Function | protein homodimerization activity | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 221 aa Download sequence Send to blast |
MEEQKAGGSD GMKKSESELA DFSAEIYGFF SDIFSGDLSS FPVNKTRDIV NGFSTCGGLT 60 ESCFLWSQNT NPKNSSVSVS TDAQSSLCVG SPMSANKPRV KDSQTRVAAS VSSPDQSDED 120 GLSEQSTNPH DIKRIRRMVS NRESARRSRK RKQAHLSDLE VQVDHMTGEN ASLFKQLSDA 180 TQQFRTAETN RRVLNSDVEA LRAKVKLAED MVARGSLTWR * |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 145 | 151 | RRSRKRK |
2 | 145 | 152 | RRSRKRKQ |
3 | 147 | 152 | SRKRKQ |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Pth.11088 | 0.0 | stem |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in developing seeds from 10 to 30 days after flowering (DAF). {ECO:0000269|PubMed:11133985}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that binds to the DNA specific sequence 5'-TGAGTCA-3' found in seed storage protein gene promoters. {ECO:0000269|PubMed:11133985}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Potri.006G277800.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | GU275060 | 3e-67 | GU275060.1 Populus balsamifera isolate GIL14 haplotype A G/HBF1-related bZIP protein gene, partial sequence. | |||
GenBank | GU275061 | 3e-67 | GU275061.1 Populus balsamifera isolate GIL14 haplotype B G/HBF1-related bZIP protein gene, partial sequence. | |||
GenBank | GU275062 | 3e-67 | GU275062.1 Populus balsamifera isolate HAY07 haplotype A G/HBF1-related bZIP protein gene, partial sequence. | |||
GenBank | GU275063 | 3e-67 | GU275063.1 Populus balsamifera isolate HAY07 haplotype B G/HBF1-related bZIP protein gene, partial sequence. | |||
GenBank | GU275064 | 3e-67 | GU275064.1 Populus balsamifera isolate INU03 haplotype A G/HBF1-related bZIP protein gene, partial sequence. | |||
GenBank | GU275065 | 3e-67 | GU275065.1 Populus balsamifera isolate INU03 haplotype B G/HBF1-related bZIP protein gene, partial sequence. | |||
GenBank | GU275066 | 3e-67 | GU275066.1 Populus balsamifera isolate KUU07 haplotype A G/HBF1-related bZIP protein gene, partial sequence. | |||
GenBank | GU275067 | 3e-67 | GU275067.1 Populus balsamifera isolate KUU07 haplotype B G/HBF1-related bZIP protein gene, partial sequence. | |||
GenBank | GU275068 | 3e-67 | GU275068.1 Populus balsamifera isolate LOV02 haplotype A G/HBF1-related bZIP protein gene, partial sequence. | |||
GenBank | GU275069 | 3e-67 | GU275069.1 Populus balsamifera isolate LOV02 haplotype B G/HBF1-related bZIP protein gene, partial sequence. | |||
GenBank | GU275070 | 3e-67 | GU275070.1 Populus balsamifera isolate MGR10 haplotype A G/HBF1-related bZIP protein gene, partial sequence. | |||
GenBank | GU275071 | 3e-67 | GU275071.1 Populus balsamifera isolate MGR10 haplotype B G/HBF1-related bZIP protein gene, partial sequence. | |||
GenBank | GU275072 | 3e-67 | GU275072.1 Populus balsamifera isolate NWL07 haplotype A G/HBF1-related bZIP protein gene, partial sequence. | |||
GenBank | GU275073 | 3e-67 | GU275073.1 Populus balsamifera isolate NWL07 haplotype B G/HBF1-related bZIP protein gene, partial sequence. | |||
GenBank | GU275074 | 3e-67 | GU275074.1 Populus balsamifera isolate POR11 haplotype A G/HBF1-related bZIP protein gene, partial sequence. | |||
GenBank | GU275075 | 3e-67 | GU275075.1 Populus balsamifera isolate POR11 haplotype B G/HBF1-related bZIP protein gene, partial sequence. | |||
GenBank | GU275076 | 3e-67 | GU275076.1 Populus balsamifera isolate RNA13 haplotype A G/HBF1-related bZIP protein gene, partial sequence. | |||
GenBank | GU275077 | 3e-67 | GU275077.1 Populus balsamifera isolate RNA13 haplotype B G/HBF1-related bZIP protein gene, partial sequence. | |||
GenBank | GU275078 | 3e-67 | GU275078.1 Populus balsamifera isolate WHR03 haplotype A G/HBF1-related bZIP protein gene, partial sequence. | |||
GenBank | GU275079 | 3e-67 | GU275079.1 Populus balsamifera isolate WHR03 haplotype B G/HBF1-related bZIP protein gene, partial sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006382195.1 | 1e-158 | basic leucine zipper 9 | ||||
Swissprot | Q6H500 | 2e-56 | RSBZ4_ORYSJ; bZIP transcription factor RISBZ4 | ||||
TrEMBL | U5GEY1 | 1e-157 | U5GEY1_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0006s29250.1 | 1e-158 | (Populus trichocarpa) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G24800.1 | 2e-55 | basic leucine zipper 9 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Potri.006G277800.1 |
Entrez Gene | 18100783 |
Publications ? help Back to Top | |||
---|---|---|---|
|