PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Potri.004G119400.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 166aa MW: 18595.2 Da PI: 4.3844 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 81.7 | 1.6e-25 | 8 | 130 | 2 | 128 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvka.eekewyfFskrdkkyatgkrknratksgyWkatgk.d 89 ++G++F P d++lvv+yLk+k+ g++l++ + i+++d+y + P +Lp ++ + +ew+fFs+++k +++ gy + Potri.004G119400.1 8 AAGYKFCPMDDDLVVYYLKRKILGEQLPA-NLIPTIDVYASSPDKLPlGLFQLgQANEWFFFSTKSKDD-----DITVIDGGYYEIDPDgA 92 68***************************.89***************5433332667******998864.....4567899**99554426 PP NAM 90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 +++ +g+ vg ktL fy+g+ p+g+ t+W+++e+r+ Potri.004G119400.1 93 APITW-EGKIVGHVKTLFFYQGSPPNGTDTEWMVEEFRI 130 77877.999****************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 5.36E-31 | 7 | 158 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 30.579 | 7 | 159 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.5E-14 | 9 | 130 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 166 aa Download sequence Send to blast |
MSSGVPVAAG YKFCPMDDDL VVYYLKRKIL GEQLPANLIP TIDVYASSPD KLPLGLFQLG 60 QANEWFFFST KSKDDDITVI DGGYYEIDPD GAAPITWEGK IVGHVKTLFF YQGSPPNGTD 120 TEWMVEEFRI NPEFVPVDKA DHNTQEKITN LVVCKIYRMR PLPEP* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 3e-18 | 10 | 158 | 20 | 164 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 3e-18 | 10 | 158 | 20 | 164 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 3e-18 | 10 | 158 | 20 | 164 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 3e-18 | 10 | 158 | 20 | 164 | NO APICAL MERISTEM PROTEIN |
3swm_A | 3e-18 | 10 | 158 | 23 | 167 | NAC domain-containing protein 19 |
3swm_B | 3e-18 | 10 | 158 | 23 | 167 | NAC domain-containing protein 19 |
3swm_C | 3e-18 | 10 | 158 | 23 | 167 | NAC domain-containing protein 19 |
3swm_D | 3e-18 | 10 | 158 | 23 | 167 | NAC domain-containing protein 19 |
3swp_A | 3e-18 | 10 | 158 | 23 | 167 | NAC domain-containing protein 19 |
3swp_B | 3e-18 | 10 | 158 | 23 | 167 | NAC domain-containing protein 19 |
3swp_C | 3e-18 | 10 | 158 | 23 | 167 | NAC domain-containing protein 19 |
3swp_D | 3e-18 | 10 | 158 | 23 | 167 | NAC domain-containing protein 19 |
4dul_A | 3e-18 | 10 | 158 | 20 | 164 | NAC domain-containing protein 19 |
4dul_B | 3e-18 | 10 | 158 | 20 | 164 | NAC domain-containing protein 19 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Potri.004G119400.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002306067.2 | 1e-120 | NAC domain-containing protein 83 isoform X1 | ||||
TrEMBL | A0A2K2ATE1 | 1e-119 | A0A2K2ATE1_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0004s11840.1 | 1e-105 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF14452 | 7 | 18 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69490.1 | 2e-22 | NAC-like, activated by AP3/PI |
Link Out ? help Back to Top | |
---|---|
Phytozome | Potri.004G119400.1 |