PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Potri.001G266000.5 | ||||||||
Common Name | POPTR_0001s27300g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 159aa MW: 17519.5 Da PI: 9.7549 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 102.6 | 3.7e-32 | 14 | 70 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 +ep+YVNaKQ+++I++RRq+Rak+e ekk k rkpylheSRh+hA+rR+Rg+gGrF Potri.001G266000.5 14 EEPVYVNAKQFNGIMRRRQARAKAELEKKA-VKVRKPYLHESRHQHAMRRARGCGGRF 70 69***************************9.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 5.6E-36 | 12 | 73 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 37.536 | 13 | 73 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 6.8E-29 | 15 | 70 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 1.2E-23 | 16 | 38 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 18 | 38 | IPR018362 | CCAAT-binding factor, conserved site |
PRINTS | PR00616 | 1.2E-23 | 47 | 70 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 159 aa Download sequence Send to blast |
MTHARMPLPL EMEEEPVYVN AKQFNGIMRR RQARAKAELE KKAVKVRKPY LHESRHQHAM 60 RRARGCGGRF LNTKKLDHNA ANPTSDKGTG DLDSSGDLQE GKESMVQDMQ THASSNCHGN 120 GNGLSSRYHS LSDDGSFLGQ QKETTHGNGV SNGNVSIY* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 9e-21 | 14 | 77 | 2 | 65 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Pth.18250 | 0.0 | bud| stem |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Potri.001G266000.5 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HQ914440 | 1e-99 | HQ914440.1 Populus euphratica CCAAT-binding transcription factor subunit B mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002299939.2 | 1e-115 | nuclear transcription factor Y subunit A-1 | ||||
TrEMBL | B9GFD8 | 1e-113 | B9GFD8_POPTR; NF-YA family protein | ||||
STRING | POPTR_0001s27300.1 | 1e-114 | (Populus trichocarpa) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G34720.1 | 1e-17 | nuclear factor Y, subunit A4 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Potri.001G266000.5 |
Entrez Gene | 7480078 |