PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G242000.1
Common NamePOPTR_0001s24880g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 653aa    MW: 74303 Da    PI: 7.2846
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G242000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS369.44.7e-1132786483374
                GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                         +lL+ cA+a  sgdl+ a+  L+++++++sp gd++qRla+yf+++L+arla+++  l+  ++ s+t+    ++ l+a++l++ ++P+ k+
  Potri.001G242000.1 278 TLLILCAQAAGSGDLKTASGKLKQIRQHSSPLGDANQRLAHYFANGLEARLAGTGMPLSGPITQSSTT---AADILKAYELYVTICPFRKM 365
                         689**************************************************888888666555555...9******************* PP

                GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlv 182
                         +++ aN++I + v++++ vHiiDf+is+G+QWp+++   + Rp+ p ++R+Tg++ p++g   +e++eetg+rL++fA++++vpfe+n+ +
  Potri.001G242000.1 366 TNMCANRTISRLVDKATSVHIIDFGISYGFQWPCFIYRQSLRPGRPTKIRVTGIELPQPGfrPAERVEETGRRLQRFADRMKVPFEYNA-I 455
                         ***********************************************************9*****************************.7 PP

                GRAS 183 akrledleleeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                         a+++e++++e+L++++  +E+++Vn++++l++l+d+++ ++s+rd+vLkl+k+++P+++ +  ++ ++n++ F++rf eal +ysa+fd+l
  Potri.001G242000.1 456 AQKWETIQYEDLKIDRdrDEVIIVNCMYRLKNLPDDTMVVNSPRDAVLKLIKRINPDIFLHGVSNGSYNAPFFVTRFREALFHYSAFFDML 546
                         **************9999************************************************************************* PP

                GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgW 362
                         ea++pre++er   Ere++gr++ nv+aceg++r+er e +++W++r  + GF++vpl +++ k +k + +++++d + v+e+ ++++lgW
  Potri.001G242000.1 547 EATAPREDQERLLFEREMIGRDAINVIACEGTQRVERPEPYKQWHMRNLRIGFRQVPLHQSIIKRVKNIKHEYHKD-FIVDEDGQWILLGW 636
                         **************************************************************************77.************** PP

                GRAS 363 kdrpLvsvSaWr 374
                         k+r + +vSaW+
  Potri.001G242000.1 637 KGRIIHAVSAWK 648
                         ***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.53250629IPR005202Transcription factor GRAS
PfamPF035141.6E-110278648IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 653 aa     Download sequence    Send to blast
MDPPSYPTNL QAPADNPSLR STSDGESPFD SETTDCYHAV LKYIHDILME DGLGDKTCML  60
QDSLALQAAE KSLYDVIGEE YPSSSDHCPP CLMNINERPD ENFTPTRSVQ SSVTQPFDSP  120
ESMPYLHVET QPFGQLNGVM GSANKSIPYS HSIKFSSMRN VSDPQELERE VMADRIQRNG  180
RNYSSIQTRG RRNHQHDNNG YLEEGRSKKQ SSASESLHLE LLDDTYLYNI ENGGHIPCPL  240
YGNSPSARNK KFLQSEQSAA SDMRTRALAN KRETDLWTLL ILCAQAAGSG DLKTASGKLK  300
QIRQHSSPLG DANQRLAHYF ANGLEARLAG TGMPLSGPIT QSSTTAADIL KAYELYVTIC  360
PFRKMTNMCA NRTISRLVDK ATSVHIIDFG ISYGFQWPCF IYRQSLRPGR PTKIRVTGIE  420
LPQPGFRPAE RVEETGRRLQ RFADRMKVPF EYNAIAQKWE TIQYEDLKID RDRDEVIIVN  480
CMYRLKNLPD DTMVVNSPRD AVLKLIKRIN PDIFLHGVSN GSYNAPFFVT RFREALFHYS  540
AFFDMLEATA PREDQERLLF EREMIGRDAI NVIACEGTQR VERPEPYKQW HMRNLRIGFR  600
QVPLHQSIIK RVKNIKHEYH KDFIVDEDGQ WILLGWKGRI IHAVSAWKPV QE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-482806488375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G242000.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002299864.20.0scarecrow-like protein 30
TrEMBLB9GJL70.0B9GJL7_POPTR; Uncharacterized protein
STRINGPOPTR_0001s24880.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Representative plantOGRP26615129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-166GRAS family protein