PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pta012892 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
|
||||||||
Family | HB-other | ||||||||
Protein Properties | Length: 124aa MW: 14407.3 Da PI: 9.4392 | ||||||||
Description | HB-other family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 60 | 3.8e-19 | 9 | 64 | 2 | 57 |
T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS Homeobox 2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 +kR+ t++q+e+Le+ +++++yp+++++++L+++lgL+e+qV+ WF rR k+kk Pta012892 9 QKRRLKTPSQVEALENIYAEHKYPTESMKAKLSRELGLSEKQVQRWFRHRRLKDKK 64 589999************************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50071 | 16.277 | 5 | 65 | IPR001356 | Homeobox domain |
SMART | SM00389 | 1.4E-17 | 8 | 69 | IPR001356 | Homeobox domain |
CDD | cd00086 | 7.79E-17 | 9 | 66 | No hit | No description |
Pfam | PF00046 | 1.3E-16 | 9 | 64 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 3.67E-18 | 9 | 71 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 1.2E-19 | 10 | 73 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 124 aa Download sequence Send to blast |
MEDKGFVEQK RRLKTPSQVE ALENIYAEHK YPTESMKAKL SRELGLSEKQ VQRWFRHRRL 60 KDKKGKKEEP DSNEELDAGS GSNLQQQQHL VRTEMGRSEK KRLLGISDYP SAVLAAELND 120 HDML |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Highly expressed in growing tissues such as inflorescence and flower meristems, young leaves and floral organs. Expressed in roots, rosette and cauline leaves, stems, flowers, inflorescences and siliques. {ECO:0000269|PubMed:22694359}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator required for the maintenance of the plant vegetative phase. In association with CHR11 or CHR17 may prevent the early activation of the vegetative-to-reproductive transition by regulating key genes that contribute to flower timing, such as FT, SEP1, SEP3, AGL8/FUL, SOC1 and FLC. {ECO:0000269|PubMed:22694359}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010276612.1 | 4e-22 | PREDICTED: uncharacterized protein LOC104611309 | ||||
Swissprot | F4HY56 | 4e-17 | RLT1_ARATH; Homeobox-DDT domain protein RLT1 | ||||
TrEMBL | D5ABF4 | 2e-78 | D5ABF4_PICSI; Uncharacterized protein | ||||
STRING | GLYMA04G15260.1 | 1e-21 | (Glycine max) | ||||
STRING | XP_010276612.1 | 1e-21 | (Nelumbo nucifera) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G03250.1 | 6e-23 | HB-other family protein |