PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Psi010634

Organism

Picea sitchensis

Taxonomic ID

3332

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea

Family

MYB

Protein Properties

Length: 113aa MW: 12948.8 Da PI: 9.4908

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
gnl\|UG\|Psi#S37594555	PU_ref	Unigene	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	51.1	3.1e-16	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd +lv ++ +G g W++ ++ g+ R++k+c++rw +yl Psi010634 14 KGAWTQEEDARLVAHIQAHGEGAWRSLPKAAGLLRCGKSCRLRWINYL 61 79****************************99**********97 PP
2	Myb_DNA-binding	59.9	5.5e-19	67	110	1	46
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg++++eEdel+++ + +lG++ W++Iar ++ gRt++++k++w++ Psi010634 67 RGNFSEEEDELIIKFHSRLGNK-WSLIARILP-GRTDNEIKNHWNT 110 89******************.*****.*********95 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.3E-23	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	14.908	9	61	IPR017930	Myb domain
SMART	SM00717	1.4E-11	13	63	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	1.76E-30	13	108	IPR009057	Homeodomain-like
Pfam	PF00249	6.2E-14	14	61	IPR001005	SANT/Myb domain
CDD	cd00167	2.47E-8	16	61	No hit	No description
PROSITE profile	PS51294	23.913	62	113	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	7.3E-25	65	110	IPR009057	Homeodomain-like
SMART	SM00717	7.2E-12	66	113	IPR001005	SANT/Myb domain
Pfam	PF00249	9.3E-17	67	110	IPR001005	SANT/Myb domain
CDD	cd00167	7.75E-12	69	110	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 113 aa Download sequence Send to blast
MGRSPCCEKA HTNKGAWTQE EDARLVAHIQ AHGEGAWRSL PKAAGLLRCG KSCRLRWINY 60 LRPDLKRGNF SEEEDELIIK FHSRLGNKWS LIARILPGRT DNEIKNHWNT PSC

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	4e-32	13	110	26	122	MYB TRANSFORMING PROTEIN
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Widely expressed at low level. Highly expressed in siliques. Weakly expressed in seedlings, young and mature leaves, cauline leaves, stems, flower buds and roots. {ECO:0000269\|PubMed:9839469}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269\|PubMed:11080161}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269\|PubMed:11080161}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_022860897.1	2e-68	myb-related protein 308-like
Swissprot	Q9SZP1	8e-69	MYB4_ARATH; Transcription repressor MYB4
TrEMBL	Q27IP2	1e-74	Q27IP2_PINTA; R2R3-MYB transcription factor MYB14
STRING	GSMUA_Achr1P07550_001	1e-67	(Musa acuminata)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G38620.1	3e-71	myb domain protein 4

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Schenke D,Cai D,Scheel D Suppression of UV-B stress responses by flg22 is regulated at the chromatin level via histone modification. Plant Cell Environ., 2014. 37(7): p. 1716-21 [PMID:24450952] Zhou M, et al. Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] Zhang J, et al. Soybean SPX1 is an important component of the response to phosphate deficiency for phosphorus homeostasis. Plant Sci., 2016. 248: p. 82-91 [PMID:27181950] Zhou M, et al. LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275] Verma N,Burma PK Regulation of tapetum-specific A9 promoter by transcription factors AtMYB80, AtMYB1 and AtMYB4 in Arabidopsis thaliana and Nicotiana tabacum. Plant J., 2017. 92(3): p. 481-494 [PMID:28849604]