PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Psi010211 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
|
||||||||
Family | VOZ | ||||||||
Protein Properties | Length: 141aa MW: 16388.6 Da PI: 9.1503 | ||||||||
Description | VOZ family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | VOZ | 269.8 | 3.5e-83 | 1 | 135 | 66 | 200 |
VOZ 66 lsakvqgkevgipecegaatakspwnaaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssf 165 l ak+ gk vgipecegaatakspwna+elfdl +l+ge +rewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmk++gg krsyymdpqpss+f Psi010211 1 LGAKTMGKAVGIPECEGAATAKSPWNAPELFDLFFLQGEVVREWLFFDKPRRAFESGNRKQRSLPDYSGRGWHESRKQVMKDLGGVKRSYYMDPQPSSQF 100 579************************************************************************************************* PP VOZ 166 ewhlyeyeineldalalyrlelklvdekksakgkv 200 ewhl+eye+n++da+ lyrlelk+vd+kk++kg+ Psi010211 101 EWHLFEYEMNNCDACVLYRLELKQVDSKKNTKGRW 135 ********************************986 PP |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 141 aa Download sequence Send to blast |
LGAKTMGKAV GIPECEGAAT AKSPWNAPEL FDLFFLQGEV VREWLFFDKP RRAFESGNRK 60 QRSLPDYSGR GWHESRKQVM KDLGGVKRSY YMDPQPSSQF EWHLFEYEMN NCDACVLYRL 120 ELKQVDSKKN TKGRWATTLD R |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Ubiquitous. Expressed in the vascular bundles of various tissues, specifically in the phloem. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011626288.1 | 3e-78 | transcription factor VOZ1 | ||||
Refseq | XP_011626289.1 | 3e-78 | transcription factor VOZ1 | ||||
Refseq | XP_018855072.1 | 6e-79 | PREDICTED: transcription factor VOZ1-like | ||||
Refseq | XP_018860320.1 | 2e-78 | PREDICTED: transcription factor VOZ1-like isoform X2 | ||||
Swissprot | Q9SGQ0 | 2e-74 | VOZ1_ARATH; Transcription factor VOZ1 | ||||
TrEMBL | A0A199VTN3 | 4e-79 | A0A199VTN3_ANACO; Transcription factor VOZ1 | ||||
TrEMBL | A0A2G5CV06 | 1e-77 | A0A2G5CV06_AQUCA; Uncharacterized protein | ||||
STRING | Aquca_036_00034.1 | 2e-78 | (Aquilegia coerulea) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G28520.2 | 7e-77 | vascular plant one zinc finger protein |
Publications ? help Back to Top | |||
---|---|---|---|
|