PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Psi006453
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family WOX
Protein Properties Length: 477aa    MW: 52625.8 Da    PI: 7.2108
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Psi#S50072736PU_unrefUnigeneView CDS
PUT-183a-Picea_sitchensis-11510PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.38.5e-21130189357
                --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
   Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                +R+++t++q+++Le +++   r+p+ae++e+++++l    +++ ++V++WFqN++a+e++
  Psi006453 130 TRWNPTPDQIRILEMFYKGgMRTPNAEQIEHITAQLrqygKIEGKNVFYWFQNHKARERQ 189
                7*****************99**************************************97 PP

2Wus_type_Homeobox117.56e-38129191365
  Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                         tRW+Ptp+Qi+iLe+ yk G+rtPn+e+i++ita+L++yGkie+kNVfyWFQN+kaRerqkq
          Psi006453 129 GTRWNPTPDQIRILEMFYKGGMRTPNAEQIEHITAQLRQYGKIEGKNVFYWFQNHKARERQKQ 191
                        69***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.252125190IPR001356Homeobox domain
SuperFamilySSF466896.84E-12126195IPR009057Homeodomain-like
SMARTSM003894.9E-8127194IPR001356Homeobox domain
PfamPF000461.6E-18130189IPR001356Homeobox domain
CDDcd000869.41E-7130191No hitNo description
Gene3DG3DSA:1.10.10.602.2E-7131189IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 477 aa     Download sequence    Send to blast
MANINSVANM PFTCENGGCN KRFRPLVPKL TLSSSSTAPM ANAVWSTQQS HDPYNQLQQA  60
FCSASSGNSV SVSAAACFLE PKISRLDGKA DENSNQRNQI DRLIKGDQQN MKEEQAESCA  120
VQSQPTASGT RWNPTPDQIR ILEMFYKGGM RTPNAEQIEH ITAQLRQYGK IEGKNVFYWF  180
QNHKARERQK QKRNSSMQQV AATAAKKTPT TIIADNPNEL HKPNSNGTYS LYNLPFTTMS  240
EDSRLMFASS SLLALPCSKG LATSLAQVGV DVRTPATTGA KRDGLEVLKR SSHGPPQVQM  300
NDEGSPSKNS VIWDSINSGG EGIITNLALS QAAADMPVNV NSCKRKNRLW QVMTPNEELG  360
LHTESSSESI CLQTSSDPIN PSEYIDEEDH RELQTLQLFP LRPEGSLKSK GETNMDNSML  420
SLHVNPSSTC PYPFREINKS AESSTQKGAI FEDHKYSKAA EFFPNFSADY SFLNSMT
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Psi.140290.0shoot
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLB8LN480.0B8LN48_PICSI; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G46480.13e-36WUSCHEL related homeobox 4