PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT1G46480.1

Common Name

F2G19.11, WOX4

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

WOX

Protein Properties

Length: 251aa MW: 28675.3 Da PI: 9.8331

Description

WUSCHEL related homeobox 4

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT1G46480.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	64.7	1.3e-20	89	148	3	57
--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS Homeobox 3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 +R+++t+eq+ +Le l++ r+p+a+++e+++ +l +++ ++V++WFqN++a+e++ AT1G46480.1 89 TRWNPTQEQIGILEMLYKGgMRTPNAQQIEHITLQLgkygKIEGKNVFYWFQNHKARERQ 148 7***************99************************************97 PP
2	Wus_type_Homeobox	116.2	1.6e-37	89	150	4	65
Wus_type_Homeobox 4 tRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 tRW+Pt+eQi iLe+lyk G+rtPn+++i++it +L +yGkie+kNVfyWFQN+kaRerqkq AT1G46480.1 89 TRWNPTQEQIGILEMLYKGGMRTPNAQQIEHITLQLGKYGKIEGKNVFYWFQNHKARERQKQ 150 8***********************************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50071	9.766	84	149	IPR001356	Homeobox domain
SuperFamily	SSF46689	3.59E-12	85	153	IPR009057	Homeodomain-like
SMART	SM00389	8.1E-7	86	153	IPR001356	Homeobox domain
CDD	cd00086	6.99E-5	89	150	No hit	No description
Pfam	PF00046	2.6E-18	89	148	IPR001356	Homeobox domain
Gene3D	G3DSA:1.10.10.60	2.3E-7	90	148	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0001944	Biological Process	vasculature development
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0007165	Biological Process	signal transduction
GO:0010067	Biological Process	procambium histogenesis
GO:0051301	Biological Process	cell division
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000014	anatomy	rosette leaf
PO:0000293	anatomy	guard cell
PO:0005597	anatomy	cambium
PO:0009005	anatomy	root
PO:0009006	anatomy	shoot system
PO:0009046	anatomy	flower
PO:0009053	anatomy	peduncle
PO:0020030	anatomy	cotyledon
PO:0020100	anatomy	hypocotyl
PO:0025275	anatomy	procambium

Sequence ? help Back to Top
Protein Sequence Length: 251 aa Download sequence Send to blast
MKVHEFSNGF SSSWDQHDST SSLSLSCKRL RPLAPKLSGS PPSPPSSSSG VTSATFDLKN 60 FIRPDQTGPT KFEHKRDPPH QLETHPGGTR WNPTQEQIGI LEMLYKGGMR TPNAQQIEHI 120 TLQLGKYGKI EGKNVFYWFQ NHKARERQKQ KRNNLISLSC QSSFTTTGVF NPSVTMKTRT 180 SSSLDIMREP MVEKEELVEE NEYKRTCRSW GFENLEIENR RNKNSSTMAT TFNKIIDNVT 240 LELFPLHPEG R

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	240254225	0.0
Expression Atlas	AT1G46480	-
AtGenExpress	AT1G46480	-

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes a WUSCHEL-related homeobox gene family member with 65 amino acids in its homeodomain. Proteins in this family contain a sequence of eight residues (TLPLFPMH) downstream of the homeodomain called the WUS box. This protein also contains an acidic domain approximately 10 residues upstream of the WUS box. Part of the TDIF-TDR-WOX4 signaling pathway that plays a crucial role in the maintenance of the vascular meristem organization during secondary growth.
UniProt	Transcription factor which may be involved in developmental processes. {ECO:0000250}.

Function -- GeneRIF ? help Back to Top
Arabidopsis plants with down-regulated WOX4 expression exhibit reduced vascular development and overaccumulate undifferentiated ground tissue. [PMID: 20044450] WOX4 is upregulated very rapidly in response to TDIF application in a TDR-dependent manner. [PMID: 20729381] Auxin-dependent stimulation of cambium activity depends on WOX4 and its upstream regulator PXY. [PMID: 21926336] WOX4 acts redundantly with WOX14 in the regulation of vascular cell division, but not in regulating vascular organisation [PMID: 23578929]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT1G46480.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Interaction ? help Back to Top
Source	Intact With
IntAct	Search Q6X7J9

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT1G46480

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY251396	0.0	AY251396.1 Arabidopsis thaliana WOX4 protein mRNA, complete cds.
GenBank	BT010692	0.0	BT010692.1 Arabidopsis thaliana At1g46480 mRNA, complete cds.
GenBank	BT010974	0.0	BT010974.1 Arabidopsis thaliana At1g46480 mRNA, complete cds.
GenBank	FJ440850	0.0	FJ440850.1 Arabidopsis thaliana WOX4 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_175145.2	0.0	WUSCHEL related homeobox 4
Swissprot	Q6X7J9	0.0	WOX4_ARATH; WUSCHEL-related homeobox 4
TrEMBL	A0A384KVK6	0.0	A0A384KVK6_ARATH; WOX4
TrEMBL	B7U6X4	0.0	B7U6X4_ARATH; WOX4
STRING	AT1G46480.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM5980	27	47
Representative plant	OGRP7167	11	17

Link Out ? help Back to Top
Phytozome	AT1G46480.1
Entrez Gene	841113
iHOP	AT1G46480
wikigenes	AT1G46480

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Haecker A, et al. Expression dynamics of WOX genes mark cell fate decisions during early embryonic patterning in Arabidopsis thaliana. Development, 2004. 131(3): p. 657-68 [PMID:14711878] Wagner R,Pfannschmidt T Eukaryotic transcription factors in plastids--Bioinformatic assessment and implications for the evolution of gene expression machineries in plants. Gene, 2006. 381: p. 62-70 [PMID:16934950] Rehrauer H, et al. AGRONOMICS1: a new resource for Arabidopsis transcriptome profiling. Plant Physiol., 2010. 152(2): p. 487-99 [PMID:20032078] Ji J, et al. WOX4 promotes procambial development. Plant Physiol., 2010. 152(3): p. 1346-56 [PMID:20044450] Ji J,Shimizu R,Sinha N,Scanlon MJ Analyses of WOX4 transgenics provide further evidence for the evolution of the WOX gene family during the regulation of diverse stem cell functions. Plant Signal Behav, 2010. 5(7): p. 916-20 [PMID:20495368] Hirakawa Y,Kondo Y,Fukuda H TDIF peptide signaling regulates vascular stem cell proliferation via the WOX4 homeobox gene in Arabidopsis. Plant Cell, 2010. 22(8): p. 2618-29 [PMID:20729381] Zhang X,Zong J,Liu J,Yin J,Zhang D Genome-wide analysis of WOX gene family in rice, sorghum, maize, Arabidopsis and poplar. J Integr Plant Biol, 2010. 52(11): p. 1016-26 [PMID:20977659] Agusti J,Lichtenberger R,Schwarz M,Nehlin L,Greb T Characterization of transcriptome remodeling during cambium formation identifies MOL1 and RUL1 as opposing regulators of secondary growth. PLoS Genet., 2011. 7(2): p. e1001312 [PMID:21379334] Arabidopsis Interactome Mapping Consortium Evidence for network evolution in an Arabidopsis interactome map. Science, 2011. 333(6042): p. 601-7 [PMID:21798944] Suer S,Agusti J,Sanchez P,Schwarz M,Greb T WOX4 imparts auxin responsiveness to cambium cells in Arabidopsis. Plant Cell, 2011. 23(9): p. 3247-59 [PMID:21926336] Causier B,Ashworth M,Guo W,Davies B The TOPLESS interactome: a framework for gene repression in Arabidopsis. Plant Physiol., 2012. 158(1): p. 423-38 [PMID:22065421] Etchells JP,Provost CM,Turner SR Plant vascular cell division is maintained by an interaction between PXY and ethylene signalling. PLoS Genet., 2012. 8(11): p. e1002997 [PMID:23166504] Ohmori Y,Tanaka W,Kojima M,Sakakibara H,Hirano HY WUSCHEL-RELATED HOMEOBOX4 is involved in meristem maintenance and is negatively regulated by the CLE gene FCP1 in rice. Plant Cell, 2013. 25(1): p. 229-41 [PMID:23371950] Etchells JP,Provost CM,Mishra L,Turner SR WOX4 and WOX14 act downstream of the PXY receptor kinase to regulate plant vascular proliferation independently of any role in vascular organisation. Development, 2013. 140(10): p. 2224-34 [PMID:23578929] Kim DY,Scalf M,Smith LM,Vierstra RD Advanced proteomic analyses yield a deep catalog of ubiquitylation targets in Arabidopsis. Plant Cell, 2013. 25(5): p. 1523-40 [PMID:23667124] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Zhou Y, et al. Control of plant stem cell function by conserved interacting transcriptional regulators. Nature, 2015. 517(7534): p. 377-80 [PMID:25363783] Dolzblasz A, et al. Stem Cell Regulation by Arabidopsis WOX Genes. Mol Plant, 2016. 9(7): p. 1028-39 [PMID:27109605] Guo X, et al. Identification of cyst nematode B-type CLE peptides and modulation of the vascular stem cell pathway for feeding cell formation. PLoS Pathog., 2017. 13(2): p. e1006142 [PMID:28158306] Denis E, et al. WOX14 promotes bioactive gibberellin synthesis and vascular cell differentiation in Arabidopsis. Plant J., 2017. 90(3): p. 560-572 [PMID:28218997] Kucukoglu M,Nilsson J,Zheng B,Chaabouni S,Nilsson O WUSCHEL-RELATED HOMEOBOX4 (WOX4)-like genes regulate cambial cell division activity and secondary growth in Populus trees. New Phytol., 2017. 215(2): p. 642-657 [PMID:28609015] Yamaguchi YL, et al. Root-Knot and Cyst Nematodes Activate Procambium-Associated Genes in Arabidopsis Roots. Front Plant Sci, 2017. 8: p. 1195 [PMID:28747918]