PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Prupe.8G069300.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 224aa MW: 25302.7 Da PI: 9.0157 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 86.2 | 1.9e-27 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+i+n++ rqvtfskRr g++KKA+ELS+LCdae+a+++fs tgkl+ey s Prupe.8G069300.1.p 9 KKIDNTTARQVTFSKRRRGLFKKAQELSTLCDAEIALVVFSATGKLFEYTS 59 68***********************************************75 PP | |||||||
2 | K-box | 54.4 | 5.6e-19 | 96 | 175 | 18 | 97 |
K-box 18 qqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 + +a L kei + +e+R+l+Ge+L++L++keLq+Le+ L ++l+++R+ K e++l++i l+ k ++ +enk+L+++ Prupe.8G069300.1.p 96 SSTSAALSKEIAESTHELRKLMGEELQELNMKELQELEKLLGSGLRRVRDAKGEFFLKEITSLKWKGSQMMQENKRLKQM 175 4566789999999999*************************************************************997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 2.1E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 29.885 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 3.66E-30 | 2 | 74 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.2E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.97E-38 | 3 | 75 | No hit | No description |
Pfam | PF00319 | 2.6E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.2E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.2E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 11.528 | 92 | 186 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 1.1E-17 | 97 | 175 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 224 aa Download sequence Send to blast |
MTRRKIQIKK IDNTTARQVT FSKRRRGLFK KAQELSTLCD AEIALVVFSA TGKLFEYTSS 60 SVQQVIERHG LLSSNYDQLN QPSLELQSFG MSQLESSTSA ALSKEIAEST HELRKLMGEE 120 LQELNMKELQ ELEKLLGSGL RRVRDAKGEF FLKEITSLKW KGSQMMQENK RLKQMANRQV 180 QTLELEQGQS SEPIGDFIHS YPSQDHDSSD TSLKLGQAFP NGI* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 6e-20 | 1 | 82 | 1 | 75 | MEF2C |
5f28_B | 6e-20 | 1 | 82 | 1 | 75 | MEF2C |
5f28_C | 6e-20 | 1 | 82 | 1 | 75 | MEF2C |
5f28_D | 6e-20 | 1 | 82 | 1 | 75 | MEF2C |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Widely expressed with highest levels in shoot tips and axillary buds. Also found in fully developed pedicels and flowers. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Putative transcription factor that coordinates gene expression underlying the differentiation of the pedicel abscission zone. May also be involved in the maintenance of the inflorescence meristem state. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Prupe.8G069300.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KT803846 | 0.0 | KT803846.1 Prunus mume SVP-like protein 2 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020409383.1 | 1e-162 | MADS-box protein JOINTLESS isoform X2 | ||||
Swissprot | Q9FUY6 | 6e-72 | JOIN_SOLLC; MADS-box protein JOINTLESS | ||||
TrEMBL | A0A251MUD7 | 1e-161 | A0A251MUD7_PRUPE; Uncharacterized protein | ||||
STRING | XP_008237141.1 | 1e-143 | (Prunus mume) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF890 | 33 | 106 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G22540.1 | 1e-73 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Prupe.8G069300.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|