PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Prupe.5G208500.1.p | ||||||||
Common Name | PRUPE_ppa010308mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 256aa MW: 29219.9 Da PI: 7.9791 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 94.9 | 3.6e-30 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtfskRr g+lKKA+E+SvLCdaeva+i+fs++gkl+eys+ Prupe.5G208500.1.p 9 KRIENKINRQVTFSKRRSGLLKKAQEISVLCDAEVALIVFSTKGKLFEYST 59 79***********************************************96 PP | |||||||
2 | K-box | 104.4 | 1.4e-34 | 78 | 174 | 4 | 100 |
K-box 4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaL 94 ++ +++++ + s++ e+akLk+++e Lqr+ h++GedL+sLslkeLq+LeqqL+++lk+iRs+Kn++++e+i+elqkk k+lqe+n+ L Prupe.5G208500.1.p 78 KQLLANDHESTGSWTLEHAKLKARVEVLQRNCSHFMGEDLQSLSLKELQNLEQQLDSALKHIRSRKNQVMYESISELQKKDKALQEQNNLL 168 555556778899******************************************************************************* PP K-box 95 rkklee 100 kk++e Prupe.5G208500.1.p 169 AKKVKE 174 ***986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 3.6E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 32.254 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 9.78E-42 | 2 | 79 | No hit | No description |
SuperFamily | SSF55455 | 1.44E-33 | 2 | 91 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.2E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 5.7E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.2E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.2E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 7.4E-28 | 85 | 172 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 16.611 | 88 | 178 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010077 | Biological Process | maintenance of inflorescence meristem identity | ||||
GO:0010154 | Biological Process | fruit development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 256 aa Download sequence Send to blast |
MGRGRVQLKR IENKINRQVT FSKRRSGLLK KAQEISVLCD AEVALIVFST KGKLFEYSTD 60 SCMERILERY ERYSYSEKQL LANDHESTGS WTLEHAKLKA RVEVLQRNCS HFMGEDLQSL 120 SLKELQNLEQ QLDSALKHIR SRKNQVMYES ISELQKKDKA LQEQNNLLAK KVKEKEKALA 180 PQAESWEQQV QNQGLDCSST LLPEALQSLN FGSGSNYQGI RNDGSGGDHE DENETPTANR 240 PNTLLPPWML RHLNE* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 2e-21 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 2e-21 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_R | 2e-21 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_S | 2e-21 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6byy_A | 2e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_B | 2e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_C | 2e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_D | 2e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_A | 2e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_B | 2e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_C | 2e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_D | 2e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6c9l_A | 2e-21 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_B | 2e-21 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_C | 2e-21 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_D | 2e-21 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_E | 2e-21 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_F | 2e-21 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Ppe.449 | 0.0 | fruit |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed during the early stages of tuberization. {ECO:0000269|PubMed:8756601}. | |||||
Uniprot | TISSUE SPECIFICITY: Abundant in vegetative organs. {ECO:0000269|PubMed:8543185}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Prupe.5G208500.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM076976 | 0.0 | AM076976.1 Prunus persica mRNA for putative MADS box protein. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007209500.1 | 0.0 | truncated transcription factor CAULIFLOWER A isoform X1 | ||||
Swissprot | Q42429 | 1e-117 | AGL8_SOLTU; Agamous-like MADS-box protein AGL8 homolog | ||||
TrEMBL | Q3ZU97 | 0.0 | Q3ZU97_PRUPE; Putative MADS box protein | ||||
STRING | EMJ10699 | 0.0 | (Prunus persica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF588 | 32 | 119 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G60910.1 | 7e-99 | AGAMOUS-like 8 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Prupe.5G208500.1.p |
Entrez Gene | 18776358 |
Publications ? help Back to Top | |||
---|---|---|---|
|