PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Prupe.5G126600.1.p

Organism

Prunus persica

Taxonomic ID

3760

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus

Family

MYB

Protein Properties

Length: 286aa MW: 32218.1 Da PI: 5.8153

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Prupe.5G126600.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	50.4	5.3e-16	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+ Ed ll+++++ +G g+W++ +++ g+ R++k+c++rw +yl Prupe.5G126600.1.p 14 RGSWTAREDALLIQYIQSHGEGHWSSLPNKAGLLRCGKSCRLRWMNYL 61 89****************************99**********97 PP
2	Myb_DNA-binding	55.8	1.1e-17	67	111	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg+ T+eEd+l+v+++++lG++ W++Ia +++ gRt++++k++w+++ Prupe.5G126600.1.p 67 RGNITPEEDDLIVRLHALLGNR-WSLIAGRLP-GRTDNEIKNYWNTH 111 7999****************.*****.**********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	15.25	9	61	IPR017930	Myb domain
SuperFamily	SSF46689	1.12E-29	11	108	IPR009057	Homeodomain-like
SMART	SM00717	1.7E-12	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	2.3E-14	14	61	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	2.5E-23	15	68	IPR009057	Homeodomain-like
CDD	cd00167	8.04E-10	16	61	No hit	No description
PROSITE profile	PS51294	26.602	62	116	IPR017930	Myb domain
SMART	SM00717	2.3E-16	66	114	IPR001005	SANT/Myb domain
Pfam	PF00249	8.5E-16	67	111	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	2.0E-26	69	116	IPR009057	Homeodomain-like
CDD	cd00167	5.35E-12	71	112	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 286 aa Download sequence Send to blast
MGRAPCCSKV GLHRGSWTAR EDALLIQYIQ SHGEGHWSSL PNKAGLLRCG KSCRLRWMNY 60 LRPDIKRGNI TPEEDDLIVR LHALLGNRWS LIAGRLPGRT DNEIKNYWNT HIAKRLRIQK 120 TSTQEVAPKP KSKCVQAEEA KKSDDDHENI GATTKRTKLH LPKPTRVSPV KTPVGSFCDG 180 EGDHEQEVGF YDAEVPNYFH ASWSDDMKKE DDDCFGEGLV CGENVEDCYD FVQVFDPARS 240 QNSEEAAAAA ERVAMTWKIC EEYEQDLKAD QDHGQLESFV DSLLI*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	2e-25	12	116	25	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in roots, leaves, stems and flowers (PubMed:17015446, PubMed:19161942). Expressed in stomatal guard cells (PubMed:19161942). {ECO:0000269\|PubMed:17015446, ECO:0000269\|PubMed:19161942}.
Uniprot	TISSUE SPECIFICITY: Widely expressed at low level. Highly expressed in siliques. Weakly expressed in seedlings, young and mature leaves, cauline leaves, stems, flower buds and roots. {ECO:0000269\|PubMed:9839469}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in cold-regulation of CBF genes and in the development of freezing tolerance. May be part of a complex network of transcription factors controlling the expression of CBF genes and other genes in response to cold stress. Binds to the MYB recognition sequences in the promoters of CBF1, CBF2 and CBF3 genes (PubMed:17015446). Involved in drought and salt tolerance. May enhance expression levels of genes involved in abscisic acid (ABA) biosynthesis and signaling, as well as those encoding stress-protective proteins (PubMed:19161942). {ECO:0000269\|PubMed:17015446, ECO:0000269\|PubMed:19161942}.
UniProt	Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269\|PubMed:11080161}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Prupe.5G126600.1.p

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269\|PubMed:11080161}.
UniProt	INDUCTION: Induced by abscisic acid (ABA) and drought stress (PubMed:19161942). Induced by salt stress (PubMed:19161942). {ECO:0000269\|PubMed:19161942}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020419855.1	0.0	transcription factor MYB6
Swissprot	Q9LTC4	3e-60	MYB15_ARATH; Transcription factor MYB15
Swissprot	Q9SZP1	3e-60	MYB4_ARATH; Transcription repressor MYB4
TrEMBL	A0A251P7N1	0.0	A0A251P7N1_PRUPE; Uncharacterized protein
STRING	XP_008239196.1	0.0	(Prunus mume)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF31	34	817

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G22640.1	1e-62	myb domain protein 3

Link Out ? help Back to Top
Phytozome	Prupe.5G126600.1.p

Publications ? help Back to Top
Schnaubelt D, et al. Low glutathione regulates gene expression and the redox potentials of the nucleus and cytosol in Arabidopsis thaliana. Plant Cell Environ., 2015. 38(2): p. 266-79 [PMID:24329757] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Schenke D,Cai D,Scheel D Suppression of UV-B stress responses by flg22 is regulated at the chromatin level via histone modification. Plant Cell Environ., 2014. 37(7): p. 1716-21 [PMID:24450952] Ma X, et al. CYCLIN-DEPENDENT KINASE G2 regulates salinity stress response and salt mediated flowering in Arabidopsis thaliana. Plant Mol. Biol., 2015. 88(3): p. 287-99 [PMID:25948280] Zhou M, et al. Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] Zhang J, et al. Soybean SPX1 is an important component of the response to phosphate deficiency for phosphorus homeostasis. Plant Sci., 2016. 248: p. 82-91 [PMID:27181950] Zhou M, et al. LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275] Kim SH, et al. Phosphorylation of the transcriptional repressor MYB15 by mitogen-activated protein kinase 6 is required for freezing tolerance in Arabidopsis. Nucleic Acids Res., 2017. 45(11): p. 6613-6627 [PMID:28510716] Chezem WR,Memon A,Li FS,Weng JK,Clay NK SG2-Type R2R3-MYB Transcription Factor MYB15 Controls Defense-Induced Lignification and Basal Immunity in Arabidopsis. Plant Cell, 2017. 29(8): p. 1907-1926 [PMID:28733420] Pal S, et al. TransDetect Identifies a New Regulatory Module Controlling Phosphate Accumulation. Plant Physiol., 2017. 175(2): p. 916-926 [PMID:28827455] Verma N,Burma PK Regulation of tapetum-specific A9 promoter by transcription factors AtMYB80, AtMYB1 and AtMYB4 in Arabidopsis thaliana and Nicotiana tabacum. Plant J., 2017. 92(3): p. 481-494 [PMID:28849604]