PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Prupe.3G307800.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 237aa MW: 26925.6 Da PI: 8.3204 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 85 | 4.4e-27 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 kri++k++rqvtfskRr g++KKA ELSvLC +ev +iifs +g+lye++s Prupe.3G307800.1.p 9 KRIDDKIRRQVTFSKRRSGLIKKARELSVLCSVEVGLIIFSAKGRLYEFCS 59 79***********************************************96 PP | |||||||
2 | K-box | 33.8 | 1.4e-12 | 124 | 196 | 28 | 100 |
K-box 28 ienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100 +++L++ q l +++e+L++ eL qLe+qL++ l++ Rs+K++l+++++ l +kek+lqee+ ++k+++e Prupe.3G307800.1.p 124 NRSLKTIQSELEAQNIENLDVTELTQLEKQLDTLLRQTRSRKTQLMMDSLTALIEKEKQLQEEKLLMEKEIAE 196 7889999999999**************************************************9998888875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 30.137 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.9E-34 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.96E-26 | 2 | 67 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.42E-33 | 2 | 67 | No hit | No description |
PRINTS | PR00404 | 4.8E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.8E-23 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.8E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.8E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 9.241 | 110 | 200 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 5.6E-10 | 125 | 194 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 237 aa Download sequence Send to blast |
MGRGKVQLKR IDDKIRRQVT FSKRRSGLIK KARELSVLCS VEVGLIIFSA KGRLYEFCSG 60 ERFQLVELNT LHKEEKNLVL FANLGKVLER YQIHNDEENA APKSGGGTGK KNPSEWNGLC 120 AGPNRSLKTI QSELEAQNIE NLDVTELTQL EKQLDTLLRQ TRSRKTQLMM DSLTALIEKE 180 KQLQEEKLLM EKEIAELKEQ KNKEQAEEAD QQSCSANNNN NSDDNAPPRQ TMLHLF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 2e-16 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 2e-16 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
1tqe_R | 2e-16 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
1tqe_S | 2e-16 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
5f28_A | 2e-16 | 1 | 77 | 1 | 81 | MEF2C |
5f28_B | 2e-16 | 1 | 77 | 1 | 81 | MEF2C |
5f28_C | 2e-16 | 1 | 77 | 1 | 81 | MEF2C |
5f28_D | 2e-16 | 1 | 77 | 1 | 81 | MEF2C |
6bz1_A | 2e-16 | 1 | 86 | 1 | 90 | MEF2 CHIMERA |
6bz1_B | 2e-16 | 1 | 86 | 1 | 90 | MEF2 CHIMERA |
6bz1_C | 2e-16 | 1 | 86 | 1 | 90 | MEF2 CHIMERA |
6bz1_D | 2e-16 | 1 | 86 | 1 | 90 | MEF2 CHIMERA |
6c9l_A | 2e-16 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
6c9l_B | 2e-16 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
6c9l_C | 2e-16 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
6c9l_D | 2e-16 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
6c9l_E | 2e-16 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
6c9l_F | 2e-16 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Prupe.3G307800.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KM243370 | 0.0 | KM243370.1 Prunus pseudocerasus CAULIFLOWER A-like protein mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020414816.1 | 1e-139 | truncated transcription factor CAULIFLOWER A isoform X2 | ||||
TrEMBL | A0A251Q994 | 1e-171 | A0A251Q994_PRUPE; Uncharacterized protein | ||||
STRING | XP_008231097.1 | 1e-152 | (Prunus mume) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF15778 | 2 | 2 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G65050.2 | 6e-34 | AGAMOUS-like 31 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Prupe.3G307800.1.p |