PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT5G65050.2 | ||||||||
Common Name | AGL31, MAF2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 178aa MW: 19980.7 Da PI: 6.5584 | ||||||||
Description | AGAMOUS-like 31 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 65.1 | 7.5e-21 | 9 | 56 | 1 | 48 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48 krienks rqvtfskRrng++ KA LS+LC+ +av+++s +gkly AT5G65050.2 9 KRIENKSSRQVTFSKRRNGLIEKARQLSILCESSIAVLVVSGSGKLYK 56 79********************************************96 PP | |||||||
2 | K-box | 39.2 | 2.9e-14 | 92 | 164 | 23 | 98 |
K-box 23 kLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 Lk+ +e q+ +l ++++ s+ L +Le+qLe++l+ R++K+el++ +++ lqk e+ l+een++L +++ AT5G65050.2 92 PLKELLEIVQS---KLEESNVDNASVDTLISLEEQLETALSVTRARKTELMMGEVKSLQKTENLLREENQTLASQV 164 55555555554...47778899999***********************************************9987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF55455 | 1.23E-25 | 1 | 74 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 27.74 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 7.7E-31 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.34E-31 | 2 | 78 | No hit | No description |
PRINTS | PR00404 | 1.7E-23 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 7.3E-21 | 10 | 55 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.7E-23 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.7E-23 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 11.003 | 80 | 170 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 1.3E-10 | 97 | 164 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009910 | Biological Process | negative regulation of flower development | ||||
GO:0010221 | Biological Process | negative regulation of vernalization response | ||||
GO:0030154 | Biological Process | cell differentiation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0006339 | anatomy | juvenile vascular leaf | ||||
PO:0006340 | anatomy | adult vascular leaf | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009005 | anatomy | root | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009047 | anatomy | stem | ||||
PO:0009049 | anatomy | inflorescence |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 178 aa Download sequence Send to blast |
MGRKKVEIKR IENKSSRQVT FSKRRNGLIE KARQLSILCE SSIAVLVVSG SGKLYKSASG 60 DNMSKIIDRY EIHHADELEA LDLAEKTRNY LPLKELLEIV QSKLEESNVD NASVDTLISL 120 EEQLETALSV TRARKTELMM GEVKSLQKTE NLLREENQTL ASQVTKTSLE ANSSVDTQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 2e-17 | 1 | 85 | 1 | 92 | MEF2C |
5f28_B | 2e-17 | 1 | 85 | 1 | 92 | MEF2C |
5f28_C | 2e-17 | 1 | 85 | 1 | 92 | MEF2C |
5f28_D | 2e-17 | 1 | 85 | 1 | 92 | MEF2C |
6byy_A | 3e-17 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
6byy_B | 3e-17 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
6byy_C | 3e-17 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
6byy_D | 3e-17 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
6bz1_A | 3e-17 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
6bz1_B | 3e-17 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
6bz1_C | 3e-17 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
6bz1_D | 3e-17 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
At.49225 | 0.0 | bud| flower| inflorescence| leaf| root |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
Genevisible | 247217_s_at | 1e-159 | ||||
Expression Atlas | AT5G65050 | - | ||||
AtGenExpress | AT5G65050 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in most plant tissues, roots, seedlings, leaves, stems, inflorescences, pollen, siliques and flowers. {ECO:0000269|PubMed:11115127, ECO:0000269|PubMed:12837945, ECO:0000269|PubMed:12949148}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | Originally published as Agamous like MADS-box protein AGL31. One of a group of MADS box genes involved in control of flowering time. Four variant sequences have been identified for this locus but have not been characterized for differences in expression pattern and/or function. | |||||
UniProt | Probable transcription factor that prevents vernalization by short periods of cold. Acts as a floral repressor. {ECO:0000269|PubMed:12724541, ECO:0000269|PubMed:19139056, ECO:0000269|PubMed:20551443}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT5G65050.2 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Requires EARLY FLOWERING 7 (ELF7) and ELF8 to be expressed. Up-regulated by HUA2. {ECO:0000269|PubMed:15520273, ECO:0000269|PubMed:15659097}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Target Gene (A: Activate/R: Repress) | |||||
ATRM | AT2G45660(R) |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT5G65050 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF312667 | 0.0 | AF312667.1 Arabidopsis thaliana MADS-box protein AGL31 (AGL31) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001078798.1 | 1e-124 | AGAMOUS-like 31 | ||||
Swissprot | Q9FPN7 | 1e-115 | AGL31_ARATH; Agamous-like MADS-box protein AGL31 | ||||
TrEMBL | A0A178UKR6 | 1e-112 | A0A178UKR6_ARATH; MAF2 | ||||
STRING | AT5G65050.3 | 1e-113 | (Arabidopsis thaliana) |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT5G65050.2 |
Entrez Gene | 836629 |
iHOP | AT5G65050 |
wikigenes | AT5G65050 |