PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Prupe.3G286800.2.p | ||||||||
Common Name | PRUPE_ppa011751mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 155aa MW: 17563.8 Da PI: 9.0237 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 56.4 | 7e-18 | 26 | 69 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg+ T+eE++l+ ++++++G++ W++Ia++++ gRt++++k++w++ Prupe.3G286800.2.p 26 RGNITPEEQLLIMELHAKWGNR-WSKIAKHLP-GRTDNEIKNYWRT 69 7999******************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 7.096 | 1 | 20 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.4E-11 | 6 | 32 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 1.42E-22 | 6 | 78 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 25.859 | 21 | 75 | IPR017930 | Myb domain |
SMART | SM00717 | 1.8E-15 | 25 | 73 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 9.5E-17 | 26 | 69 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 7.20E-13 | 30 | 69 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 4.0E-21 | 33 | 71 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009740 | Biological Process | gibberellic acid mediated signaling pathway | ||||
GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway | ||||
GO:0080086 | Biological Process | stamen filament development | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 155 aa Download sequence Send to blast |
MSLGLKRTGK SCRLRWLNYL RPDVRRGNIT PEEQLLIMEL HAKWGNRWSK IAKHLPGRTD 60 NEIKNYWRTR IQKHIKQAEN NITPGQISEV NDQASTSQVS ISSAAVDTMA ITHAAPANYP 120 PNMDAYPSSL PADHSHEGYW SIEDLWSMQL LNGE* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 1e-18 | 7 | 75 | 40 | 108 | B-MYB |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: First detected in 15-20 mm buds. Expression increases as flowers develop. {ECO:0000269|PubMed:1840903}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed only in flowers. {ECO:0000269|PubMed:1840903}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. {ECO:0000305}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Prupe.3G286800.2.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007217766.1 | 1e-109 | myb-related protein 305 | ||||
Swissprot | P81391 | 3e-67 | MYB05_ANTMA; Myb-related protein 305 | ||||
TrEMBL | A0A251Q6Y9 | 1e-111 | A0A251Q6Y9_PRUPE; Uncharacterized protein | ||||
STRING | EMJ18965 | 1e-109 | (Prunus persica) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G27810.1 | 2e-60 | myb domain protein 21 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Prupe.3G286800.2.p |
Entrez Gene | 18782007 |
Publications ? help Back to Top | |||
---|---|---|---|
|