PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT3G27810.1

Common Name

ATMYB21, ATMYB3, MGF10.23, MYB21

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MYB

Protein Properties

Length: 226aa MW: 25351.1 Da PI: 6.9604

Description

myb domain protein 21

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT3G27810.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	54.8	2.1e-17	22	69	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT eEd++l+++++ +G g W++ a+ g++Rt+k+c++rw++yl AT3G27810.1 22 KGPWTMEEDLILINYIANHGDGVWNSLAKSAGLKRTGKSCRLRWLNYL 69 79********************************************97 PP
2	Myb_DNA-binding	54	3.9e-17	75	118	1	46
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg+ T+eE++++ ++++++G++ W++Ia++++ gRt++++k++w++ AT3G27810.1 75 RGNITPEEQLIIMELHAKWGNR-WSKIAKHLP-GRTDNEIKNFWRT 118 7999****************.*****.*********96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	14.998	17	69	IPR017930	Myb domain
SuperFamily	SSF46689	7.49E-30	20	116	IPR009057	Homeodomain-like
SMART	SM00717	1.8E-12	21	71	IPR001005	SANT/Myb domain
Pfam	PF00249	1.9E-16	22	69	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	6.5E-23	23	76	IPR009057	Homeodomain-like
CDD	cd00167	2.34E-10	24	69	No hit	No description
PROSITE profile	PS51294	24.865	70	124	IPR017930	Myb domain
SMART	SM00717	5.0E-15	74	122	IPR001005	SANT/Myb domain
Pfam	PF00249	8.4E-16	75	118	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.1E-24	77	123	IPR009057	Homeodomain-like
CDD	cd00167	3.39E-12	79	118	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006357	Biological Process	regulation of transcription from RNA polymerase II promoter
GO:0009585	Biological Process	red, far-red light phototransduction
GO:0009740	Biological Process	gibberellic acid mediated signaling pathway
GO:0009867	Biological Process	jasmonic acid mediated signaling pathway
GO:0030154	Biological Process	cell differentiation
GO:0080086	Biological Process	stamen filament development
GO:0005634	Cellular Component	nucleus
GO:0000981	Molecular Function	RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135	Molecular Function	transcription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000293	anatomy	guard cell
PO:0009009	anatomy	plant embryo
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009052	anatomy	flower pedicel
PO:0009062	anatomy	gynoecium
PO:0025022	anatomy	collective leaf structure
PO:0025281	anatomy	pollen
PO:0001185	developmental stage	plant embryo globular stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 226 aa Download sequence Send to blast
MEKRGGGSSG GSGSSAEAEV RKGPWTMEED LILINYIANH GDGVWNSLAK SAGLKRTGKS 60 CRLRWLNYLR PDVRRGNITP EEQLIIMELH AKWGNRWSKI AKHLPGRTDN EIKNFWRTRI 120 QKYIKQSDVT TTSSVGSHHS SEINDQAAST SSHNVFCTQD QAMETYSPTP TSYQHTNMEF 180 NYGNYSAAAV TATVDYPVPM TVDDQTGENY WGMDDIWSSM HLLNGN

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	7e-26	19	124	24	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	30688934	0.0
Genevisible	257220_at	0.0
Expression Atlas	AT3G27810	-
AtGenExpress	AT3G27810	-
ATTED-II	AT3G27810	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Mainly expressed in floral tissues. expressed in all four whorls of the flower, in the anther vascular tissue and in cells at the junction between anther and stamen filaments. Detected in the nectaries and ovules. {ECO:0000269\|PubMed:16805732, ECO:0000269\|PubMed:19325888, ECO:0000269\|Ref.1}.

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes a member of the R2R3-MYB transcription factor gene family. Induced by jasmonate. Involved in jasmonate response during stamen development.
UniProt	Transcription factor involved in photomorphogenesis in the light. May act downstream of the light receptor network and directly affects transcription of light-induced genes. In darkness, its probable degradation prevent the activation of light-induced genes. Required to activate expression of PAL. Acts redundantly with MYB24 and MYB57 to control stamen filament elongation in the late developed flowers. Contributes with MYB24 to induction of MYB108 by jasmonate. Repressed at the transcript levels by DELLA proteins. {ECO:0000269\|PubMed:11967090, ECO:0000269\|PubMed:16805732, ECO:0000269\|PubMed:19091873, ECO:0000269\|PubMed:19325888, ECO:0000269\|PubMed:21447791}.

Function -- GeneRIF ? help Back to Top
ANAC019 and AtMYB3 specifically interact with the C-terminal region (640-967) of AtCPL1 containing two double-stranded RNA binding motifs. [PMID: 18541146] Excess expression of MYB21 results in retarded stamen development. [PMID: 21447791]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT3G27810.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated by jasmonate. {ECO:0000269\|PubMed:16805732}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT3G06490(A), AT3G22370(A)

Regulation -- Hormone ? help Back to Top
Source	Hormone
AHD	Gibberellin, jasmonic acid, Jasmonic acid

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT3G27810, AT4G17880, AT5G40350, AT5G46760, AT5G46830, AT1G32640

Phenotype -- Disruption Phenotype ? help Back to Top
Source	Description
UniProt	DISRUPTION PHENOTYPE: Short anther filaments, delayed anther dehiscence and greatly reduced male fertility. Myb21 and myb24 double mutant is more severely sterile than myb21 mutant and has petals that just grew out of the sepals but ended at a lower level than the stigma. Myb21 and myb57 double mutant has an intermediate sterility phenotype and petals that grew to a final height parallel to the pistil. Myb21, myb24 and myb57 triple mutant has a strongly reduced fertility and an arrested growth of the petals that never grew out of the sepals. {ECO:0000269\|PubMed:16805732, ECO:0000269\|PubMed:19325888}.

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT3G27810

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK118439	0.0	AK118439.1 Arabidopsis thaliana At3g27810 mRNA for putative myb family transcription factor (Atmyb3), complete cds, clone: RAFL19-68-M03.
GenBank	AY519589	0.0	AY519589.1 Arabidopsis thaliana MYB transcription factor (At3g27810) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_189418.2	1e-171	myb domain protein 21
Swissprot	Q9LK95	1e-172	MYB21_ARATH; Transcription factor MYB21
TrEMBL	A0A178VHJ7	1e-169	A0A178VHJ7_ARATH; MYB21
STRING	AT3G27810.1	1e-170	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646
Representative plant	OGRP5	17	1784

Link Out ? help Back to Top
Phytozome	AT3G27810.1
Entrez Gene	822401
iHOP	AT3G27810
wikigenes	AT3G27810

Publications ? help Back to Top
Stracke R,Werber M,Weisshaar B The R2R3-MYB gene family in Arabidopsis thaliana. Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56 [PMID:11597504] Seki M, et al. Functional annotation of a full-length Arabidopsis cDNA collection. Science, 2002. 296(5565): p. 141-5 [PMID:11910074] Shin B, et al. AtMYB21, a gene encoding a flower-specific transcription factor, is regulated by COP1. Plant J., 2002. 30(1): p. 23-32 [PMID:11967090] Gong W, et al. Genome-wide ORFeome cloning and analysis of Arabidopsis transcription factor genes. Plant Physiol., 2004. 135(2): p. 773-82 [PMID:15208423] Wang XJ,Cao XL,Hong Y Isolation and characterization of flower-specific transcripts in Acacia mangium. Tree Physiol., 2005. 25(2): p. 167-78 [PMID:15574398] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Li J, et al. Two groups of MYB transcription factors share a motif which enhances trans-activation activity. Biochem. Biophys. Res. Commun., 2006. 341(4): p. 1155-63 [PMID:16460676] Yanhui C, et al. The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. Plant Mol. Biol., 2006. 60(1): p. 107-24 [PMID:16463103] Mandaokar A, et al. Transcriptional regulators of stamen development in Arabidopsis identified by transcriptional profiling. Plant J., 2006. 46(6): p. 984-1008 [PMID:16805732] Cao D,Cheng H,Wu W,Soo HM,Peng J Gibberellin mobilizes distinct DELLA-dependent transcriptomes to regulate seed germination and floral development in Arabidopsis. Plant Physiol., 2006. 142(2): p. 509-25 [PMID:16920880] Manzano C,Abraham Z,L Identification of ubiquitinated proteins in Arabidopsis. Plant Mol. Biol., 2008. 68(1-2): p. 145-58 [PMID:18535787] Bang WY,Kim SW,Jeong IS,Koiwa H,Bahk JD The C-terminal region (640-967) of Arabidopsis CPL1 interacts with the abiotic stress- and ABA-responsive transcription factors. Biochem. Biophys. Res. Commun., 2008. 372(4): p. 907-12 [PMID:18541146] Colinas J,Schmidler SC,Bohrer G,Iordanov B,Benfey PN Intergenic and genic sequence lengths have opposite relationships with respect to gene expression. PLoS ONE, 2008. 3(11): p. e3670 [PMID:18989364] Mandaokar A,Browse J MYB108 acts together with MYB24 to regulate jasmonate-mediated stamen maturation in Arabidopsis. Plant Physiol., 2009. 149(2): p. 851-62 [PMID:19091873] Rowan DD, et al. Environmental regulation of leaf colour in red 35S:PAP1 Arabidopsis thaliana. New Phytol., 2009. 182(1): p. 102-15 [PMID:19192188] Cheng H, et al. Gibberellin acts through jasmonate to control the expression of MYB21, MYB24, and MYB57 to promote stamen filament growth in Arabidopsis. PLoS Genet., 2009. 5(3): p. e1000440 [PMID:19325888] Peng J Gibberellin and jasmonate crosstalk during stamen development. J Integr Plant Biol, 2009. 51(12): p. 1064-70 [PMID:20021553] Song S, et al. The Jasmonate-ZIM domain proteins interact with the R2R3-MYB transcription factors MYB21 and MYB24 to affect Jasmonate-regulated stamen development in Arabidopsis. Plant Cell, 2011. 23(3): p. 1000-13 [PMID:21447791] Reeves PH, et al. A regulatory network for coordinated flower maturation. PLoS Genet., 2012. 8(2): p. e1002506 [PMID:22346763] Li Y, et al. A cotton gene encoding MYB-like transcription factor is specifically expressed in pollen and is involved in regulation of late anther/pollen development. Plant Cell Physiol., 2013. 54(6): p. 893-906 [PMID:23447105] Su Z, et al. Flower development under drought stress: morphological and transcriptomic analyses reveal acute responses and long-term acclimation in Arabidopsis. Plant Cell, 2013. 25(10): p. 3785-807 [PMID:24179129] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Qi T,Huang H,Song S,Xie D Regulation of Jasmonate-Mediated Stamen Development and Seed Production by a bHLH-MYB Complex in Arabidopsis. Plant Cell, 2015. 27(6): p. 1620-33 [PMID:26002869] Liu Z, et al. A Conserved Cytochrome P450 Evolved in Seed Plants Regulates Flower Maturation. Mol Plant, 2015. 8(12): p. 1751-65 [PMID:26388305] Chen X,Huang H,Qi T,Liu B,Song S New perspective of the bHLH-MYB complex in jasmonate-regulated plant fertility in arabidopsis. Plant Signal Behav, 2016. 11(2): p. e1135280 [PMID:26829586] Huang H, et al. Arabidopsis MYB24 Regulates Jasmonate-Mediated Stamen Development. Front Plant Sci, 2017. 8: p. 1525 [PMID:28928760] Kranz HD, et al. Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana. Plant J., 1998. 16(2): p. 263-76 [PMID:9839469]