PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Prupe.2G280100.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 246aa MW: 27456 Da PI: 5.1934 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 52.6 | 1e-16 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++lv+ +G +W+++++ g++R++k+c++rw +yl Prupe.2G280100.1.p 14 KGPWTAEEDKKLVNFLLAHGQCCWRAVPKLAGLRRCGKSCRLRWTNYL 61 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 48.4 | 2.1e-15 | 72 | 111 | 6 | 47 |
HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 + E++l +d++ +lG++ W++Ia+ ++ gRt++++k++w+++ Prupe.2G280100.1.p 72 EAEEQLVIDLHSRLGNR-WSKIAAGLP-GRTDNEIKNHWNTH 111 67***************.*********.************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.8E-21 | 5 | 62 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 14.274 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.27E-26 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.3E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.7E-15 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.95E-9 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 25.808 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.7E-23 | 63 | 117 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.2E-13 | 66 | 114 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.35E-10 | 71 | 112 | No hit | No description |
Pfam | PF00249 | 1.4E-13 | 72 | 111 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 246 aa Download sequence Send to blast |
MGRQPCCDKL GVKKGPWTAE EDKKLVNFLL AHGQCCWRAV PKLAGLRRCG KSCRLRWTNY 60 LRPDLKRGLL NEAEEQLVID LHSRLGNRWS KIAAGLPGRT DNEIKNHWNT HIKKKLIKMG 120 IDPITHEPLC KQATPPEMPC KPNNPPADLD MNQQNVNIPE HGISSAAESS SSNESQPLEP 180 NLKSEDDPLM SYILSDTFLE DLTWDFSASS EDSSAADNPA EDNSLAWFLD CKDFGVEDFE 240 LGCIN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 2e-28 | 14 | 116 | 7 | 108 | B-MYB |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in mature flowers and decreases upon pollination. {ECO:0000269|PubMed:15805488}. | |||||
Uniprot | TISSUE SPECIFICITY: Restricted to the petals, with the highest expression in the limb. {ECO:0000269|PubMed:15805488}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | R2R3 MYB-type transcription factor controlling the production of volatile benzoides in flowers by regulating the shikimate pathway, namely by activation of the 5-enol-pyruvylshikimate-3-phosphate synthase gene. This scent, mostly produced in the evening and night by the petals, attracts the pollinators. Anthocyanins production is not controlled by ODO1 as color and scent are produced at different stages of development. {ECO:0000269|PubMed:15805488}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Prupe.2G280100.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Increases before the onset of volatile emission at the end of the light period, peaks at night and decreases when volatile emission declines early morning. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB370230 | 1e-142 | AB370230.1 Malus x domestica MdMYBB mRNA for myb-related transcription factor, complete cds. | |||
GenBank | DQ074467 | 1e-142 | DQ074467.1 Malus x domestica MYB19 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020414166.1 | 0.0 | protein ODORANT1 | ||||
Swissprot | Q50EX6 | 7e-96 | ODO1_PETHY; Protein ODORANT1 | ||||
TrEMBL | A0A251QMR3 | 0.0 | A0A251QMR3_PRUPE; Uncharacterized protein | ||||
STRING | XP_008234380.1 | 1e-178 | (Prunus mume) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF653 | 34 | 142 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G22680.1 | 2e-82 | myb domain protein 85 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Prupe.2G280100.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|