PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Prupe.2G204900.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 184aa MW: 21472.2 Da PI: 4.7074 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 78.1 | 2e-24 | 6 | 129 | 6 | 128 |
NAM 6 rFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk.......kvkaeekewyfFskrdkkya..tgkrknratksgyWkatg 87 +Pt+e+lv +L++k + +++i+e+ i ++ Pwd p + ++ ++ ++fFs+rd +y + r+n at++g+Wk+tg Prupe.2G204900.1.p 6 GLDPTEEQLV-SFLREKKQI-----DHIIPEIYIGNYVPWDVPGlyaglfaEPDSPHQPMFFFSPRDYRYIdnNYARTNSATARGFWKTTG 90 569*******.889877443.....347***************54676654333455688*********98434569999*********** PP NAM 88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 k++ +++ + + +tL+fy+gr p ++t+W+mhey+l Prupe.2G204900.1.p 91 KERVIKA--RGSILRERTLIFYEGRVPPFNQTNWIMHEYSL 129 **99998..5569999***********************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 26.348 | 1 | 154 | IPR003441 | NAC domain |
Pfam | PF02365 | 6.6E-16 | 5 | 129 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 7.32E-25 | 5 | 150 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 184 aa Download sequence Send to blast |
MNSYFGLDPT EEQLVSFLRE KKQIDHIIPE IYIGNYVPWD VPGLYAGLFA EPDSPHQPMF 60 FFSPRDYRYI DNNYARTNSA TARGFWKTTG KERVIKARGS ILRERTLIFY EGRVPPFNQT 120 NWIMHEYSLI EDEANPTPEL AQQRGFVLCC LKKIQEKKDS SIFAQPDEWP LISEEYPQPE 180 EPE* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 1e-18 | 5 | 156 | 21 | 167 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 1e-18 | 5 | 156 | 21 | 167 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 1e-18 | 5 | 156 | 21 | 167 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 1e-18 | 5 | 156 | 21 | 167 | NO APICAL MERISTEM PROTEIN |
3swm_A | 2e-18 | 5 | 156 | 24 | 170 | NAC domain-containing protein 19 |
3swm_B | 2e-18 | 5 | 156 | 24 | 170 | NAC domain-containing protein 19 |
3swm_C | 2e-18 | 5 | 156 | 24 | 170 | NAC domain-containing protein 19 |
3swm_D | 2e-18 | 5 | 156 | 24 | 170 | NAC domain-containing protein 19 |
3swp_A | 2e-18 | 5 | 156 | 24 | 170 | NAC domain-containing protein 19 |
3swp_B | 2e-18 | 5 | 156 | 24 | 170 | NAC domain-containing protein 19 |
3swp_C | 2e-18 | 5 | 156 | 24 | 170 | NAC domain-containing protein 19 |
3swp_D | 2e-18 | 5 | 156 | 24 | 170 | NAC domain-containing protein 19 |
4dul_A | 1e-18 | 5 | 156 | 21 | 167 | NAC domain-containing protein 19 |
4dul_B | 1e-18 | 5 | 156 | 21 | 167 | NAC domain-containing protein 19 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Prupe.2G204900.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007219787.2 | 1e-135 | NAC domain-containing protein 86 | ||||
TrEMBL | A0A251QM42 | 1e-134 | A0A251QM42_PRUPE; Uncharacterized protein | ||||
STRING | EMJ20986 | 1e-103 | (Prunus persica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF39849 | 2 | 2 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G17260.1 | 5e-27 | NAC domain containing protein 86 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Prupe.2G204900.1.p |