PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PSME_00053751-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
|
||||||||
Family | VOZ | ||||||||
Protein Properties | Length: 123aa MW: 13832.7 Da PI: 7.4141 | ||||||||
Description | VOZ family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | VOZ | 221.5 | 2e-68 | 2 | 122 | 36 | 156 |
VOZ 36 tlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelfdlsllegetirewlffdkprrafesgnrkqrs 128 tla neg+pg++pvlrp+gid+kdg+lfaals k+q k vgipecega+takspwna elfd+ +lege++re lffdkprr fesgnrkqrs PSME_00053751-RA 2 TLASNEGAPGMRPVLRPEGIDMKDGPLFAALSVKTQEKAVGIPECEGATTAKSPWNAYELFDMYVLEGESMRECLFFDKPRRDFESGNRKQRS 94 79******************************************************************************************* PP VOZ 129 lpdysgrgwhesrkqvmkefgglkrsyy 156 lpdysg gwhesrkqv+k+fgglkrsy PSME_00053751-RA 95 LPDYSGHGWHESRKQVIKDFGGLKRSYS 122 **************************95 PP |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 123 aa Download sequence Send to blast |
MTLASNEGAP GMRPVLRPEG IDMKDGPLFA ALSVKTQEKA VGIPECEGAT TAKSPWNAYE 60 LFDMYVLEGE SMRECLFFDK PRRDFESGNR KQRSLPDYSG HGWHESRKQV IKDFGGLKRS 120 YSV |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010904889.1 | 4e-64 | transcription factor VOZ1 | ||||
Swissprot | Q9SGQ0 | 7e-58 | VOZ1_ARATH; Transcription factor VOZ1 | ||||
TrEMBL | A0A0K9NP50 | 8e-64 | A0A0K9NP50_ZOSMR; Vascular plant one zinc finger protein | ||||
TrEMBL | A0A199VTN3 | 3e-64 | A0A199VTN3_ANACO; Transcription factor VOZ1 | ||||
STRING | ERN14021 | 4e-63 | (Amborella trichopoda) | ||||
STRING | XP_008782092.1 | 6e-63 | (Phoenix dactylifera) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G28520.2 | 3e-60 | vascular plant one zinc finger protein |
Publications ? help Back to Top | |||
---|---|---|---|
|