PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PSME_00050182-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 165aa MW: 19069.9 Da PI: 10.3498 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 57.6 | 2.8e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+eEd++l ++v+++G g W + +++ g++R++k+c++rw++yl PSME_00050182-RA 14 RGAWTAEEDLILCEYVRLHGDGGWQKLPQKAGLKRCGKSCRLRWRNYL 61 89*********************************************7 PP | |||||||
2 | Myb_DNA-binding | 47.2 | 5.1e-15 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ + +++el+++ +++lG++ W++Ia +++ gRt++++k++w++++ PSME_00050182-RA 67 RGNISYDDEELIIRMHRLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHM 112 6788999***************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.6E-23 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 23.539 | 9 | 65 | IPR017930 | Myb domain |
SMART | SM00717 | 2.1E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 6.36E-28 | 13 | 108 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 9.4E-17 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.13E-10 | 16 | 61 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 4.8E-22 | 65 | 114 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.8E-12 | 66 | 114 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 17.142 | 66 | 116 | IPR017930 | Myb domain |
Pfam | PF00249 | 4.5E-13 | 67 | 111 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 6.33E-10 | 73 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 165 aa Download sequence Send to blast |
MGRSPCCSKE VLNRGAWTAE EDLILCEYVR LHGDGGWQKL PQKAGLKRCG KSCRLRWRNY 60 LRPDINRGNI SYDDEELIIR MHRLLGNRWS LIAGRLPGRT DNEIKNYWNS HMRQNEVQLQ 120 AKAQSLKKRP KSPPLFENYV SRAIPLKIKP NCFNGYGSTT NIPTS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 4e-25 | 12 | 114 | 25 | 126 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 125 | 131 | LKKRPKS |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015954738.1 | 2e-64 | transcription factor MYB8-like | ||||
Refseq | XP_025677071.1 | 2e-64 | transcription factor MYB8-like | ||||
Swissprot | P10290 | 1e-58 | MYBC_MAIZE; Anthocyanin regulatory C1 protein | ||||
TrEMBL | A0A167V901 | 1e-69 | A0A167V901_PICAB; Transcription factor MYB30 | ||||
TrEMBL | F8TJT0 | 8e-70 | F8TJT0_PINRE; MYB-like protein (Fragment) | ||||
STRING | POPTR_0006s23840.1 | 2e-62 | (Populus trichocarpa) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G22640.1 | 9e-60 | myb domain protein 3 |