PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PSME_00049981-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 65aa MW: 7307.69 Da PI: 9.0346 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 65 | 1.8e-20 | 15 | 61 | 1 | 47 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllk 47 +CaaCk++r+kC+++Cvlapyfp+++++kf vh++FG +v+kll+ PSME_00049981-RA 15 PCAACKMQRKKCTDKCVLAPYFPQAEREKFLLVHRVFGHGHVIKLLQ 61 7*******************************************997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 16.011 | 14 | 65 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 2.9E-19 | 15 | 61 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 65 aa Download sequence Send to blast |
MGETAMNSEG LSTSPCAACK MQRKKCTDKC VLAPYFPQAE REKFLLVHRV FGHGHVIKLL 60 QVQMI |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_022964985.1 | 1e-17 | LOB domain-containing protein 11-like isoform X2 | ||||
Refseq | XP_022970429.1 | 1e-17 | LOB domain-containing protein 1-like isoform X2 | ||||
Swissprot | Q9SK08 | 2e-17 | LBD11_ARATH; LOB domain-containing protein 11 | ||||
TrEMBL | B8LQI9 | 2e-21 | B8LQI9_PICSI; Uncharacterized protein | ||||
STRING | Gorai.012G185900.1 | 4e-17 | (Gossypium raimondii) | ||||
STRING | OMERI05G01710.1 | 4e-17 | (Oryza meridionalis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G28500.1 | 8e-20 | LOB domain-containing protein 11 |