PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PSME_00048168-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 65aa MW: 7219.33 Da PI: 8.5023 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 66.1 | 8.5e-21 | 5 | 63 | 29 | 87 |
DUF260 29 kfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqql 87 +f ++hk+FGasn +kll +lp e+r++a+ s++yeAe r++dPvyG+v+++ +lq+q+ PSME_00048168-RA 5 RFGAIHKFFGASNFSKLLMHLPVENRDNAVISVLYEAEGRLQDPVYGCVSHVYALQRQV 63 799******************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 12.356 | 1 | 65 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 3.1E-19 | 4 | 63 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 65 aa Download sequence Send to blast |
MGAPRFGAIH KFFGASNFSK LLMHLPVENR DNAVISVLYE AEGRLQDPVY GCVSHVYALQ 60 RQVGL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 7e-19 | 5 | 63 | 39 | 97 | LOB family transfactor Ramosa2.1 |
5ly0_B | 7e-19 | 5 | 63 | 39 | 97 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator (PubMed:19717544, PubMed:22974309). Involved in lateral root formation. Regulated by the transcriptional activators ARF7 and ARF19 (PubMed:17259263). Functions in the initiation and emergence of lateral roots, in conjunction with LBD18, downstream of ARF7 and ARF19 (PubMed:19717544, PubMed:23749813). Acts downstream of the auxin influx carriers AUX1 and LAX1 in the regulation of lateral root initiation and development (PubMed:26059335). {ECO:0000269|PubMed:17259263, ECO:0000269|PubMed:19717544, ECO:0000269|PubMed:22974309, ECO:0000269|PubMed:23749813, ECO:0000269|PubMed:26059335}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By auxin. {ECO:0000269|PubMed:15659631, ECO:0000269|PubMed:17259263, ECO:0000269|PubMed:23749813}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009386252.1 | 7e-26 | PREDICTED: LOB domain-containing protein 29-like | ||||
Swissprot | Q9SLB7 | 4e-24 | LBD16_ARATH; LOB domain-containing protein 16 | ||||
TrEMBL | M0U784 | 2e-24 | M0U784_MUSAM; Uncharacterized protein | ||||
STRING | GSMUA_AchrUn_randomP07730_001 | 3e-25 | (Musa acuminata) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G42430.1 | 2e-26 | lateral organ boundaries-domain 16 |