PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PSME_00038331-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 105aa MW: 11542.5 Da PI: 9.3937 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 125.9 | 2e-39 | 7 | 104 | 1 | 98 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 +CaaCk++++kC+++Cvlapy+p+++p+kf vh +FG+ +v+kll++lp e+r +a+ss+vyeA r rdPv+G+vgvi++lq+++++l+++ PSME_00038331-RA 7 PCAACKIQKKKCSEKCVLAPYLPQSNPQKFLLVHTVFGNGHVIKLLQDLPAEQRAQAVSSMVYEASQRFRDPVHGCVGVISDLQKKVAELQSQ 99 7******************************************************************************************** PP DUF260 94 lallk 98 la ++ PSME_00038331-RA 100 LAFTQ 104 *9876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 23.82 | 6 | 105 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 4.5E-39 | 7 | 104 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 105 aa Download sequence Send to blast |
MSKVTSPCAA CKIQKKKCSE KCVLAPYLPQ SNPQKFLLVH TVFGNGHVIK LLQDLPAEQR 60 AQAVSSMVYE ASQRFRDPVH GCVGVISDLQ KKVAELQSQL AFTQA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 1e-33 | 6 | 100 | 10 | 104 | LOB family transfactor Ramosa2.1 |
5ly0_B | 1e-33 | 6 | 100 | 10 | 104 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004307415.1 | 3e-43 | PREDICTED: LOB domain-containing protein 1-like | ||||
Refseq | XP_022157927.1 | 3e-43 | LOB domain-containing protein 11-like | ||||
Swissprot | Q9SK08 | 2e-41 | LBD11_ARATH; LOB domain-containing protein 11 | ||||
TrEMBL | B8LQI9 | 7e-57 | B8LQI9_PICSI; Uncharacterized protein | ||||
STRING | XP_004307415.1 | 1e-42 | (Fragaria vesca) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G28500.1 | 9e-44 | LOB domain-containing protein 11 |