PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PSME_00032710-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 88aa MW: 10258.9 Da PI: 10.3626 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 34.4 | 5.3e-11 | 5 | 36 | 1 | 32 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32 +g+WT+eEd++l+ +k++G g+W++ +++ g PSME_00032710-RA 5 KGAWTAEEDQILISFIKKHGHGNWHALPNKAG 36 79************************999988 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 12.65 | 1 | 50 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.97E-9 | 1 | 36 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 2.4E-12 | 3 | 36 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 0.0046 | 4 | 45 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.6E-9 | 5 | 36 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.11E-6 | 7 | 36 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 88 aa Download sequence Send to blast |
MGLKKGAWTA EEDQILISFI KKHGHGNWHA LPNKAGLYCA RLSKYLFARI KTNSIVFFYL 60 SRRTYAMREE LSTALDKLSQ TQHKTWEL |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G23250.1 | 2e-15 | myb domain protein 15 |