PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PSME_00016951-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 159aa MW: 18383.1 Da PI: 10.2934 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 44.3 | 4.1e-14 | 75 | 120 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T+ E+ ++++ + lG++ W+tIa+ ++ gRt++++k++w+++l PSME_00016951-RA 75 RGSFTKAEERTILQLDAILGNR-WSTIASQLP-GRTENEIKNFWNSHL 120 89********************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50090 | 4.414 | 29 | 69 | IPR017877 | Myb-like domain |
Gene3D | G3DSA:1.10.10.60 | 3.6E-8 | 40 | 76 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 5.26E-18 | 56 | 128 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 22.565 | 70 | 124 | IPR017930 | Myb domain |
SMART | SM00717 | 6.1E-13 | 74 | 122 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 9.0E-13 | 75 | 120 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.6E-24 | 77 | 124 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.99E-9 | 77 | 120 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 159 aa Download sequence Send to blast |
MPPYCDSRRM RDSKRNLGFL SILVSSFVLI VMRREEGTSG HATWTALPEL AARLLRCGKT 60 YQLHWTNYLR PDVKRGSFTK AEERTILQLD AILGNRWSTI ASQLPGRTEN EIKNFWNSHL 120 KKRLLKMRLE YPSTHAPIEE VNLSDPRGYE ASALTRHEA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 9e-18 | 40 | 124 | 26 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that may play a role in flower development by repressing ANT (PubMed:19232308). Regulates the transition of meristem identity from vegetative growth to flowering. Acts downstream of LFY and upstream of AP1. Directly activates AP1 to promote floral fate. Together with LFY and AP1 may constitute a regulatory network that contributes to an abrupt and robust meristem identity transition (PubMed:21750030). {ECO:0000269|PubMed:19232308, ECO:0000269|PubMed:21750030}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_014516586.1 | 1e-44 | transcription factor MYB41 isoform X2 | ||||
Refseq | XP_017442408.1 | 2e-44 | PREDICTED: myb-related protein Zm38-like | ||||
Refseq | XP_017442409.1 | 2e-44 | PREDICTED: myb-related protein Zm38-like | ||||
Refseq | XP_022641765.1 | 2e-44 | transcription factor MYB41 isoform X1 | ||||
Swissprot | Q9M2D9 | 9e-43 | MYB17_ARATH; Transcription factor MYB17 | ||||
TrEMBL | A0A222UAM7 | 2e-44 | A0A222UAM7_GINBI; R2R3MYB15 | ||||
STRING | XP_007135039.1 | 7e-44 | (Phaseolus vulgaris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G61250.1 | 4e-45 | myb domain protein 17 |