PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT3G61250.1 | ||||||||
Common Name | AtMYB17, LMI2, MYB17, T20K12.150 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 299aa MW: 33289.7 Da PI: 6.9366 | ||||||||
Description | myb domain protein 17 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 53.7 | 4.8e-17 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEde lv +k+ G g+W+t ++ g+ R++k+c++rw +yl AT3G61250.1 14 KGPWTPEEDEVLVAHIKKNGHGSWRTLPKLAGLLRCGKSCRLRWTNYL 61 79******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 50.5 | 4.9e-16 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T++E++l +++++ lG++ W++Ia+ ++ gRt++++k+ w+++l AT3G61250.1 67 RGPFTADEEKLVIQLHAILGNR-WAAIAAQLP-GRTDNEIKNLWNTHL 112 89********************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 6.6E-24 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 16.951 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.03E-30 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 9.6E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.8E-14 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.67E-10 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 25.221 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.9E-26 | 65 | 116 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 8.4E-15 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.1E-15 | 67 | 112 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.14E-11 | 69 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006357 | Biological Process | regulation of transcription from RNA polymerase II promoter | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0009753 | Biological Process | response to jasmonic acid | ||||
GO:0009909 | Biological Process | regulation of flower development | ||||
GO:0030154 | Biological Process | cell differentiation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0000981 | Molecular Function | RNA polymerase II transcription factor activity, sequence-specific DNA binding | ||||
GO:0001135 | Molecular Function | transcription factor activity, RNA polymerase II transcription factor recruiting | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0000229 | anatomy | flower meristem | ||||
PO:0009005 | anatomy | root | ||||
PO:0009006 | anatomy | shoot system | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009010 | anatomy | seed | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009052 | anatomy | flower pedicel | ||||
PO:0020100 | anatomy | hypocotyl | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
PO:0001081 | developmental stage | mature plant embryo stage | ||||
PO:0001185 | developmental stage | plant embryo globular stage | ||||
PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 299 aa Download sequence Send to blast |
MGRTPCCDKI GLKKGPWTPE EDEVLVAHIK KNGHGSWRTL PKLAGLLRCG KSCRLRWTNY 60 LRPDIKRGPF TADEEKLVIQ LHAILGNRWA AIAAQLPGRT DNEIKNLWNT HLKKRLLSMG 120 LDPRTHEPLP SYGLAKQAPS SPTTRHMAQW ESARVEAEAR LSRESMLFSP SFYSGVVKTE 180 CDHFLRIWNS EIGEAFRNLA PLDESTITSQ SPCSRATSTS SALLKSSTNS WGGKEVTVAI 240 HGSDYSPYSN DLEDDSTDSA LQLLLDFPIS DDDMSFLEEN IDSYSQAPPI GLVSMVSKF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 9e-29 | 12 | 116 | 25 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
At.974 | 0.0 | flower |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 42566108 | 0.0 | ||||
Genevisible | 251363_at | 0.0 | ||||
Expression Atlas | AT3G61250 | - | ||||
AtGenExpress | AT3G61250 | - | ||||
ATTED-II | AT3G61250 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in cotyledon and hypocotyls of germinating seeds. {ECO:0000269|PubMed:19232308}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in the shoot apex, young flower buds, developing carpels and siliques (PubMed:19232308). Expressed in floral meristem, initiating floral primordia and developing flowers (PubMed:21750030). {ECO:0000269|PubMed:19232308, ECO:0000269|PubMed:21750030}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | Member of the R2R3 factor gene family. | |||||
UniProt | Transcription factor that may play a role in flower development by repressing ANT (PubMed:19232308). Regulates the transition of meristem identity from vegetative growth to flowering. Acts downstream of LFY and upstream of AP1. Directly activates AP1 to promote floral fate. Together with LFY and AP1 may constitute a regulatory network that contributes to an abrupt and robust meristem identity transition (PubMed:21750030). {ECO:0000269|PubMed:19232308, ECO:0000269|PubMed:21750030}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00114 | ampDAP | 27203113 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT3G61250.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator (A: Activate/R: Repress) | |||||
ATRM | AT5G13790 (A), AT5G61850 (A) |
Regulation -- Hormone ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hormone | |||||
AHD | jasmonic acid, salicylic acid |
Interaction ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Intact With | |||||
BioGRID | AT5G61850 |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT3G61250 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY519601 | 0.0 | AY519601.1 Arabidopsis thaliana MYB transcription factor (At3g61250) mRNA, complete cds. | |||
GenBank | BT033129 | 0.0 | BT033129.1 Arabidopsis thaliana unknown protein (At3g61250) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_191684.1 | 0.0 | myb domain protein 17 | ||||
Swissprot | Q9M2D9 | 0.0 | MYB17_ARATH; Transcription factor MYB17 | ||||
TrEMBL | A0A178VGX7 | 0.0 | A0A178VGX7_ARATH; MYB17 | ||||
STRING | AT3G61250.1 | 0.0 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM6982 | 26 | 43 | Representative plant | OGRP5 | 17 | 1784 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT3G61250.1 |
Entrez Gene | 825297 |
iHOP | AT3G61250 |
wikigenes | AT3G61250 |