PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PSME_00006893-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 68aa MW: 7745.47 Da PI: 7.6726 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 27.5 | 7.3e-09 | 19 | 50 | 1 | 32 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32 rg+WT+ Ed++l +++k +G g+W++ +++ g PSME_00006893-RA 19 RGAWTANEDKILTEYIKTHGVGQWRSLPKKSG 50 89*************************99987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 6.8E-10 | 13 | 48 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50090 | 6.655 | 14 | 48 | IPR017877 | Myb-like domain |
SuperFamily | SSF46689 | 3.23E-8 | 15 | 50 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 2.2E-6 | 19 | 48 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 9.28E-5 | 21 | 51 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 68 aa Download sequence Send to blast |
MGRSPSYRCA KDDDEGINRG AWTANEDKIL TEYIKTHGVG QWRSLPKKSG EPHVYNNTHH 60 TSVPSQYE |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002275148.1 | 8e-16 | PREDICTED: myb-related protein Zm38 | ||||
TrEMBL | A0A4D6V295 | 2e-15 | A0A4D6V295_9ROSI; MYB transcription factor 30 | ||||
STRING | XP_009361685.1 | 9e-15 | (Pyrus x bretschneideri) | ||||
STRING | VIT_09s0002g01400.t01 | 9e-15 | (Vitis vinifera) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G49330.1 | 1e-13 | myb domain protein 111 |