PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Peinf101Scf09408g00001.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 82aa MW: 9104.29 Da PI: 8.2673 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 63.5 | 4.1e-20 | 10 | 55 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+W++eEd l+++v q+G+++W++I+ ++ gR++k+c++rw + Peinf101Scf09408g00001.1 10 KGSWSPEEDNMLIKLVDQHGPRNWSLISTGIP-GRSGKSCRLRWCNQ 55 799*****************************.***********985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 26.428 | 5 | 60 | IPR017930 | Myb domain |
SMART | SM00717 | 1.4E-16 | 9 | 58 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.1E-19 | 10 | 55 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.2E-22 | 10 | 55 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 1.76E-21 | 11 | 82 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 7.71E-17 | 12 | 54 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 9.6E-7 | 56 | 82 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 7.182 | 61 | 82 | IPR017930 | Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 82 aa Download sequence Send to blast |
MEGTTGDKIK GSWSPEEDNM LIKLVDQHGP RNWSLISTGI PGRSGKSCRL RWCNQLSPTV 60 QHRPFTPSED AIILQAHALH GN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 2e-21 | 9 | 82 | 3 | 76 | MYB PROTO-ONCOGENE PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that functions in salt stress response. Acts as negative regulator of NHX7/SOS1 and CBL4/SOS3 induction in response to salt stress (PubMed:23809151). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB73 is enhanced by direct interaction between MYB73 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:23809151, ECO:0000269|PubMed:24894996}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salt stress. {ECO:0000269|PubMed:23809151}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019262180.1 | 8e-48 | PREDICTED: myb protein-like | ||||
Swissprot | O23160 | 5e-34 | MYB73_ARATH; Transcription factor MYB73 | ||||
TrEMBL | A0A314L8L3 | 2e-46 | A0A314L8L3_NICAT; Transcription factor myb44 | ||||
STRING | XP_009785340.1 | 8e-47 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12883 | 16 | 20 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G37260.1 | 2e-36 | myb domain protein 73 |
Publications ? help Back to Top | |||
---|---|---|---|
|