PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Peinf101Scf02602g01005.1

Organism

Petunia inflata

Taxonomic ID

212142

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia

Family

M-type_MADS

Protein Properties

Length: 62aa MW: 7086.26 Da PI: 11.2522

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Peinf101Scf02602g01005.1	genome	SGN	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	98.4	2.9e-31	10	59	2	51
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 rien + rqvtfskRrng+lKKA+ELSvLCdaev++iifs++gklye+ss Peinf101Scf02602g01005.1 10 RIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSTRGKLYEFSS 59 8***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	3.9E-39	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	31.721	1	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	4.46E-36	3	61	No hit	No description
SuperFamily	SSF55455	1.83E-29	3	61	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.6E-31	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.5E-26	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.6E-31	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.6E-31	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 62 aa Download sequence Send to blast
MVRGKTQMRR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVSLIIFST RGKLYEFSSS 60 SL

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3mu6_A	1e-18	3	62	2	61	Myocyte-specific enhancer factor 2A
3mu6_B	1e-18	3	62	2	61	Myocyte-specific enhancer factor 2A
3mu6_C	1e-18	3	62	2	61	Myocyte-specific enhancer factor 2A
3mu6_D	1e-18	3	62	2	61	Myocyte-specific enhancer factor 2A
5f28_A	1e-18	1	62	1	62	MEF2C
5f28_B	1e-18	1	62	1	62	MEF2C
5f28_C	1e-18	1	62	1	62	MEF2C
5f28_D	1e-18	1	62	1	62	MEF2C
6byy_A	2e-18	1	62	1	62	MEF2 CHIMERA
6byy_B	2e-18	1	62	1	62	MEF2 CHIMERA
6byy_C	2e-18	1	62	1	62	MEF2 CHIMERA
6byy_D	2e-18	1	62	1	62	MEF2 CHIMERA
6bz1_A	2e-18	1	62	1	62	MEF2 CHIMERA
6bz1_B	2e-18	1	62	1	62	MEF2 CHIMERA
6bz1_C	2e-18	1	62	1	62	MEF2 CHIMERA
6bz1_D	2e-18	1	62	1	62	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator active in flowering time control. May integrate signals from the photoperiod, vernalization and autonomous floral induction pathways. Can modulate class B and C homeotic genes expression. When associated with AGL24, mediates effect of gibberellins on flowering under short-day conditions, and regulates the expression of LEAFY (LFY), which links floral induction and floral development. {ECO:0000269\|PubMed:10995392, ECO:0000269\|PubMed:18339670, ECO:0000269\|PubMed:18466303, ECO:0000269\|PubMed:19656343}.
UniProt	Transcriptional activator that regulates root development by controlling meristem size and patterning of the root apical meristem. Regulates auxin transport and gradients in the root meristematic cells via direct regulation of the auxin efflux carrier PIN1 and PIN4 gene expression. Binds specifically to the CArG-box DNA sequences in the promoter regions of PIN1 and PIN4 genes (PubMed:24121311). Involved in the regulation of shoot apical meristem (SAM) cell identities and transitions. Promotes flowering transition and participates in flower meristem maintenance and determinacy. Positively regulates TFL1 and WUS expression. Binds directly to the TFL1 regulatory sequences (PubMed:25636918). {ECO:0000269\|PubMed:24121311}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By auxin. {ECO:0000269\|PubMed:24121311}.
UniProt	INDUCTION: Up-regulated by gibberellins, vernalization and under long-day conditions. Gradual increase during vegetative growth. Induced by AGL24 at the shoot apex at the floral transitional stage. Repressed by SVP during the early stages of flower development. Inhibited by AP1 in emerging floral meristems (PubMed:17428825, PubMed:18339670, PubMed:19656343). Repressed by SHL to prevent flowering (PubMed:25281686). {ECO:0000269\|PubMed:17428825, ECO:0000269\|PubMed:18339670, ECO:0000269\|PubMed:19656343, ECO:0000269\|PubMed:25281686}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY370511	4e-97	AY370511.1 Petunia x hybrida MADS-box protein FBP28 gene, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008438118.1	2e-35	PREDICTED: MADS-box protein SOC1-like isoform X1
Refseq	XP_008438119.1	1e-35	PREDICTED: MADS-box protein SOC1-like isoform X2
Refseq	XP_008438120.1	1e-35	PREDICTED: MADS-box protein SOC1-like isoform X3
Refseq	XP_016898941.1	2e-35	PREDICTED: MADS-box protein SOC1-like isoform X1
Swissprot	O64645	1e-34	SOC1_ARATH; MADS-box protein SOC1
Swissprot	Q38838	1e-34	AGL14_ARATH; Agamous-like MADS-box protein AGL14
TrEMBL	Q6UGS4	6e-35	Q6UGS4_PETHY; MADS-box protein FBP28 (Fragment)
TrEMBL	Q9ATE3	2e-34	Q9ATE3_PETHY; MADS-box transcription factor FBP28
STRING	XP_008438118.1	6e-35	(Cucumis melo)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA40	24	625

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G45660.1	5e-37	AGAMOUS-like 20

Publications ? help Back to Top
Zimmermann P,Hirsch-Hoffmann M,Hennig L,Gruissem W GENEVESTIGATOR. Arabidopsis microarray database and analysis toolbox. Plant Physiol., 2004. 136(1): p. 2621-32 [PMID:15375207] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ramamoorthy R,Phua EE,Lim SH,Tan HT,Kumar PP Identification and characterization of RcMADS1, an AGL24 ortholog from the holoparasitic plant Rafflesia cantleyi Solms-Laubach (Rafflesiaceae). PLoS ONE, 2013. 8(6): p. e67243 [PMID:23840638] Heidari B,Nemie-Feyissa D,Kangasjärvi S,Lillo C Antagonistic regulation of flowering time through distinct regulatory subunits of protein phosphatase 2A. PLoS ONE, 2013. 8(7): p. e67987 [PMID:23976921] Mouhu K, et al. The Fragaria vesca homolog of suppressor of overexpression of constans1 represses flowering and promotes vegetative growth. Plant Cell, 2013. 25(9): p. 3296-310 [PMID:24038650] Lei HJ, et al. Identification and characterization of FaSOC1, a homolog of SUPPRESSOR OF OVEREXPRESSION OF CONSTANS1 from strawberry. Gene, 2013. 531(2): p. 158-67 [PMID:24055423] Fu J, et al. Photoperiodic control of FT-like gene ClFT initiates flowering in Chrysanthemum lavandulifolium. Plant Physiol. Biochem., 2014. 74: p. 230-8 [PMID:24316581] Steinbach Y,Hennig L Arabidopsis MSI1 functions in photoperiodic flowering time control. Front Plant Sci, 2014. 5: p. 77 [PMID:24639681] Preston JC,Jorgensen SA,Jha SG Functional characterization of duplicated Suppressor of Overexpression of Constans 1-like genes in petunia. PLoS ONE, 2014. 9(5): p. e96108 [PMID:24787903] Berr A,Shafiq S,Pinon V,Dong A,Shen WH The trxG family histone methyltransferase SET DOMAIN GROUP 26 promotes flowering via a distinctive genetic pathway. Plant J., 2015. 81(2): p. 316-28 [PMID:25409787] Leal Valentim F, et al. A quantitative and dynamic model of the Arabidopsis flowering time gene regulatory network. PLoS ONE, 2015. 10(2): p. e0116973 [PMID:25719734] Ma X, et al. CYCLIN-DEPENDENT KINASE G2 regulates salinity stress response and salt mediated flowering in Arabidopsis thaliana. Plant Mol. Biol., 2015. 88(3): p. 287-99 [PMID:25948280] Kang MY, et al. Negative regulatory roles of DE-ETIOLATED1 in flowering time in Arabidopsis. Sci Rep, 2015. 5: p. 9728 [PMID:25962685] Wang C,Dehesh K From retrograde signaling to flowering time. Plant Signal Behav, 2015. 10(6): p. e1022012 [PMID:26098376] Lee JH,Jung JH,Park CM INDUCER OF CBF EXPRESSION 1 integrates cold signals into FLOWERING LOCUS C-mediated flowering pathways in Arabidopsis. Plant J., 2015. 84(1): p. 29-40 [PMID:26248809] Lee JH,Park CM Integration of photoperiod and cold temperature signals into flowering genetic pathways in Arabidopsis. Plant Signal Behav, 2015. 10(11): p. e1089373 [PMID:26430754] Li M, et al. DELLA proteins interact with FLC to repress flowering transition. J Integr Plant Biol, 2016. 58(7): p. 642-55 [PMID:26584710] Franks SJ, et al. Variation in the flowering time orthologs BrFLC and BrSOC1 in a natural population of Brassica rapa. PeerJ, 2015. 3: p. e1339 [PMID:26644966] Liu B, et al. Interplay of the histone methyltransferases SDG8 and SDG26 in the regulation of transcription and plant flowering and development. Biochim. Biophys. Acta, 2016. 1859(4): p. 581-90 [PMID:26854085] Liu XR, et al. Overexpression of an Orchid (Dendrobium nobile) SOC1/TM3-Like Ortholog, DnAGL19, in Arabidopsis Regulates HOS1-FT Expression. Front Plant Sci, 2016. 7: p. 99 [PMID:26904066] Davin N, et al. Functional network analysis of genes differentially expressed during xylogenesis in soc1ful woody Arabidopsis plants. Plant J., 2016. 86(5): p. 376-90 [PMID:26952251] Del Olmo I, et al. Arabidopsis DNA polymerase ϵ recruits components of Polycomb repressor complex to mediate epigenetic gene silencing. Nucleic Acids Res., 2016. 44(12): p. 5597-614 [PMID:26980282] Mahrez W, et al. BRR2a Affects Flowering Time via FLC Splicing. PLoS Genet., 2016. 12(4): p. e1005924 [PMID:27100965] Hyun Y, et al. Multi-layered Regulation of SPL15 and Cooperation with SOC1 Integrate Endogenous Flowering Pathways at the Arabidopsis Shoot Meristem. Dev. Cell, 2016. 37(3): p. 254-66 [PMID:27134142] He L, et al. Maize OXIDATIVE STRESS2 Homologs Enhance Cadmium Tolerance in Arabidopsis through Activation of a Putative SAM-Dependent Methyltransferase Gene. Plant Physiol., 2016. 171(3): p. 1675-85 [PMID:27208260] Alter P, et al. Flowering Time-Regulated Genes in Maize Include the Transcription Factor ZmMADS1. Plant Physiol., 2016. 172(1): p. 389-404 [PMID:27457125] Xu C,Yu Y,Zhang Y,Li Y,Wei S Gibberellins are involved in effect of near-null magnetic field on Arabidopsis flowering. Bioelectromagnetics, 2017. 38(1): p. 1-10 [PMID:27598690] Riboni M,Robustelli Test A,Galbiati M,Tonelli C,Conti L ABA-dependent control of GIGANTEA signalling enables drought escape via up-regulation of FLOWERING LOCUS T in Arabidopsis thaliana. J. Exp. Bot., 2016. 67(22): p. 6309-6322 [PMID:27733440] Kong X,Luo X,Qu GP,Liu P,Jin JB Arabidopsis SUMO protease ASP1 positively regulates flowering time partially through regulating FLC stability . J Integr Plant Biol, 2017. 59(1): p. 15-29 [PMID:27925396] Kapolas G, et al. APRF1 promotes flowering under long days in Arabidopsis thaliana. Plant Sci., 2016. 253: p. 141-153 [PMID:27968983] Li H, et al. BZR1 Positively Regulates Freezing Tolerance via CBF-Dependent and CBF-Independent Pathways in Arabidopsis. Mol Plant, 2017. 10(4): p. 545-559 [PMID:28089951] Chen J, et al. Suppressor of Overexpression of CO 1 Negatively Regulates Dark-Induced Leaf Degreening and Senescence by Directly Repressing Pheophytinase and Other Senescence-Associated Genes in Arabidopsis. Plant Physiol., 2017. 173(3): p. 1881-1891 [PMID:28096189] Denis E, et al. WOX14 promotes bioactive gibberellin synthesis and vascular cell differentiation in Arabidopsis. Plant J., 2017. 90(3): p. 560-572 [PMID:28218997] Nasim Z,Fahim M,Ahn JH Possible Role of MADS AFFECTING FLOWERING 3 and B-BOX DOMAIN PROTEIN 19 in Flowering Time Regulation of Arabidopsis Mutants with Defects in Nonsense-Mediated mRNA Decay. Front Plant Sci, 2017. 8: p. 191 [PMID:28261246] Wilson DC,Kempthorne CJ,Carella P,Liscombe DK,Cameron RK Age-Related Resistance in Arabidopsis thaliana Involves the MADS-Domain Transcription Factor SHORT VEGETATIVE PHASE and Direct Action of Salicylic Acid on Pseudomonas syringae. Mol. Plant Microbe Interact., 2017. 30(11): p. 919-929 [PMID:28812948] Qu Y, et al. Peroxisomal CuAOζ and its product H2O2 regulate the distribution of auxin and IBA-dependent lateral root development in Arabidopsis. J. Exp. Bot., 2017. 68(17): p. 4851-4867 [PMID:28992128] Zhang GZ, et al. Ectopic expression of UGT84A2 delayed flowering by indole-3-butyric acid-mediated transcriptional repression of ARF6 and ARF8 genes in Arabidopsis. Plant Cell Rep., 2017. 36(12): p. 1995-2006 [PMID:29027578] Jamge S,Stam M,Angenent GC,Immink RGH A cautionary note on the use of chromosome conformation capture in plants. Plant Methods, 2017. 13: p. 101 [PMID:29177001] Dotto M,Gómez MS,Soto MS,Casati P UV-B radiation delays flowering time through changes in the PRC2 complex activity and miR156 levels in Arabidopsis thaliana. Plant Cell Environ., 2018. 41(6): p. 1394-1406 [PMID:29447428]