PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Peinf101Scf01602g02011.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 122aa MW: 14630 Da PI: 8.5178 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 29.6 | 1.6e-09 | 66 | 105 | 4 | 45 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 +T++E++l+++ +k+ G + W +Ia +++ gRt++++ +w Peinf101Scf01602g02011.1 66 MTKQEEDLIYRMHKLVGDR-WGLIAGRIP-GRTAEEIERFWI 105 69***************99.*********.*********995 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 3.8E-7 | 62 | 110 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.66E-7 | 65 | 104 | No hit | No description |
Pfam | PF00249 | 1.1E-8 | 66 | 105 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.7E-11 | 67 | 105 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50090 | 6.26 | 67 | 104 | IPR017877 | Myb-like domain |
SuperFamily | SSF46689 | 3.98E-8 | 67 | 106 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010091 | Biological Process | trichome branching | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 122 aa Download sequence Send to blast |
MDQNLHHQPK IMHRCCSHEG TAICLSTDEV QFFLGSFYLR GQLFFSFLVL IWKTEVNSME 60 WEFISMTKQE EDLIYRMHKL VGDRWGLIAG RIPGRTAEEI ERFWIMRHSD GFAHKRRQLR 120 KV |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Involved in epidermal cell fate specification. Negative regulator of trichome development, including endoreplication, by lateral inhibition involving intercellular interactions. Promotes the formation of hair developing cells (trichoblasts) in H position in root epidermis, probably by inhibiting non-hair cell (atrichoblasts) formation. {ECO:0000269|PubMed:10368181, ECO:0000269|PubMed:12356720}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negative autoregulation. Repressed by CPC. {ECO:0000269|PubMed:12356720}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC238926 | 6e-39 | AC238926.5 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-330o5 map 1, complete sequence. | |||
GenBank | HG975440 | 6e-39 | HG975440.1 Solanum pennellii chromosome ch01, complete genome. | |||
GenBank | HG975513 | 6e-39 | HG975513.1 Solanum lycopersicum chromosome ch01, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019252947.1 | 4e-53 | PREDICTED: MYB-like transcription factor ETC3 isoform X1 | ||||
Swissprot | Q8GV05 | 5e-32 | TRY_ARATH; Transcription factor TRY | ||||
TrEMBL | A0A1S4CLV6 | 1e-47 | A0A1S4CLV6_TOBAC; MYB-like transcription factor ETC3 | ||||
TrEMBL | A0A1U7VH58 | 1e-47 | A0A1U7VH58_NICSY; MYB-like transcription factor ETC3 | ||||
STRING | XP_009761639.1 | 2e-48 | (Nicotiana sylvestris) | ||||
STRING | XP_009623671.1 | 2e-48 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA11707 | 18 | 24 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G53200.1 | 2e-34 | MYB_related family protein |