PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Peinf101Scf01329g05013.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 187aa MW: 21629.8 Da PI: 9.0706 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 92.2 | 2.5e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+i+n + rqvtfskRr g++KKAeELSvLCda+va+iifsstgkl+eyss Peinf101Scf01329g05013.1 9 KKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEYSS 59 68***********************************************96 PP | |||||||
2 | K-box | 50 | 1.2e-17 | 91 | 170 | 18 | 97 |
K-box 18 qqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 + ++++L +ei++ + +R++ Ge+L+ Ls++eLqqLe+ Le +l ++ ++K + ++++i++lq+k el een++Lr++ Peinf101Scf01329g05013.1 91 NSNYSRLSREISEKSHRLRQMRGEELQGLSIEELQQLERTLEAGLGRVIERKGDKIMREINQLQQKGLELMEENEKLRQQ 170 4679999*****999***************************************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 2.2E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 30.628 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 4.78E-39 | 2 | 77 | No hit | No description |
SuperFamily | SSF55455 | 1.31E-31 | 3 | 76 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.0E-28 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 3.9E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.0E-28 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.0E-28 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 13.02 | 87 | 180 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 2.5E-16 | 92 | 170 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009266 | Biological Process | response to temperature stimulus | ||||
GO:0009910 | Biological Process | negative regulation of flower development | ||||
GO:0010076 | Biological Process | maintenance of floral meristem identity | ||||
GO:0010582 | Biological Process | floral meristem determinacy | ||||
GO:0030154 | Biological Process | cell differentiation | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0048438 | Biological Process | floral whorl development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0000900 | Molecular Function | translation repressor activity, nucleic acid binding | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 187 aa Download sequence Send to blast |
MAREKIQIKK IDNATARQVT FSKRRRGLFK KAEELSVLCD ADVALIIFSS TGKLFEYSSS 60 SMKEILERRD LHSKNLEKLD QPSLELQLVE NSNYSRLSRE ISEKSHRLRQ MRGEELQGLS 120 IEELQQLERT LEAGLGRVIE RKGDKIMREI NQLQQKGLEL MEENEKLRQQ ATLLGLKGEE 180 QMLIANS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 2e-21 | 1 | 66 | 1 | 66 | MEF2C |
5f28_B | 2e-21 | 1 | 66 | 1 | 66 | MEF2C |
5f28_C | 2e-21 | 1 | 66 | 1 | 66 | MEF2C |
5f28_D | 2e-21 | 1 | 66 | 1 | 66 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Putative transcription factor that coordinates gene expression underlying the differentiation of the pedicel abscission zone. May also be involved in the maintenance of the inflorescence meristem state. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00272 | DAP | Transfer from AT2G22540 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FJ666098 | 0.0 | FJ666098.1 Petunia x hybrida EXTRAPETALS mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010312646.1 | 1e-114 | MADS-box protein JOINTLESS isoform X1 | ||||
Swissprot | Q9FUY6 | 1e-110 | JOIN_SOLLC; MADS-box protein JOINTLESS | ||||
TrEMBL | D1MBJ9 | 1e-115 | D1MBJ9_PETHY; EXTRAPETALS | ||||
STRING | XP_009783886.1 | 1e-110 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA938 | 23 | 77 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G22540.1 | 1e-100 | MIKC_MADS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|