PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Peinf101Scf00336g23040.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 84aa MW: 9639.07 Da PI: 9.6882 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 54.2 | 3.4e-17 | 30 | 77 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT +Ed +l++++ +lG g+W++ a+ g++R++k+c++rw++yl Peinf101Scf00336g23040.1 30 KGPWTLDEDSILIHYISLLGQGRWDSLAQFAGLKRSGKSCRLRWLNYL 77 79*********************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 21.622 | 25 | 81 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 7.48E-17 | 25 | 83 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 6.3E-20 | 29 | 80 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 8.4E-14 | 29 | 79 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.0E-16 | 30 | 77 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.02E-11 | 32 | 77 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 84 aa Download sequence Send to blast |
MEEVKATQVT YSSGMPVTVN LAEDNIEMRK GPWTLDEDSI LIHYISLLGQ GRWDSLAQFA 60 GLKRSGKSCR LRWLNYLRPN LRRG |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. {ECO:0000305}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016504485.1 | 6e-34 | PREDICTED: transcription factor MYB108-like | ||||
Swissprot | P81391 | 1e-25 | MYB05_ANTMA; Myb-related protein 305 | ||||
TrEMBL | A0A1S4CTP6 | 1e-32 | A0A1S4CTP6_TOBAC; transcription factor MYB108-like | ||||
STRING | XP_009631883.1 | 3e-33 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G40350.1 | 1e-27 | myb domain protein 24 |
Publications ? help Back to Top | |||
---|---|---|---|
|