PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G40350.1
Common NameAtMYB24, MPO12.60, MYB24
Organism
Arabidopsis thaliana
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 214aa    MW: 24459.3 Da    PI: 7.2329
Description myb domain protein 24
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G40350.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.41.4e-171966148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++l+++++ +G g W++ a+  g++Rt+k+c++rw++yl
      AT5G40350.1 19 KGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRWLNYL 66
                     79********************************************97 PP
2Myb_DNA-binding52.89.1e-1772115146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T+eE++ + ++++++G++ W++Ia++++ gRt++++k++w++
      AT5G40350.1  72 RGNITPEEQLTIMELHAKWGNR-WSKIAKHLP-GRTDNEIKNFWRT 115
                      7999******************.*********.***********96 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.9171466IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-231469IPR009057Homeodomain-like
SuperFamilySSF466895.62E-3017113IPR009057Homeodomain-like
SMARTSM007178.1E-131868IPR001005SANT/Myb domain
PfamPF002491.5E-161966IPR001005SANT/Myb domain
CDDcd001673.28E-102166No hitNo description
PROSITE profilePS5129423.97367121IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.0E-2470120IPR009057Homeodomain-like
SMARTSM007171.5E-1471119IPR001005SANT/Myb domain
PfamPF002491.2E-1572115IPR001005SANT/Myb domain
CDDcd001672.47E-1176115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0030154Biological Processcell differentiation
GO:0080086Biological Processstamen filament development
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0009009anatomyplant embryo
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009052anatomyflower pedicel
PO:0009062anatomygynoecium
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001185developmental stageplant embryo globular stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MEKRESSGGS GSGDAEVRKG PWTMEEDLIL INYIANHGEG VWNSLAKSAG LKRTGKSCRL  60
RWLNYLRPDV RRGNITPEEQ LTIMELHAKW GNRWSKIAKH LPGRTDNEIK NFWRTKIQKY  120
IIKSGETTTV GSQSSEFINH HATTSHVMND TQETMDMYSP TTSYQHASNI NQQLNYGNYV  180
PESGSIMMPL SVDQSEQNYW SVDDLWPMNI YNGN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-251412122128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453586760.0
Genevisible249349_at0.0
Expression AtlasAT5G40350-
AtGenExpressAT5G40350-
ATTED-IIAT5G40350-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Tightly regulated during anther development. {ECO:0000269|PubMed:16972096}.
UniprotTISSUE SPECIFICITY: Expressed specifically in flowers. Expressed in all four whorls of the flower and in the vascular tissue of stamen filament and sepals. Detected in male and female gametophytes, especially in microspores and ovules. Weakly expressed in petals and the upper part of pistils. {ECO:0000269|PubMed:16805732, ECO:0000269|PubMed:16972096, ECO:0000269|PubMed:19325888}.
Functional Description ? help Back to Top
Source Description
TAIRMyb24 transcription factor. Member of the R2R3 factor gene family. Induced by jasmonate. Involved in jasmonate response during stamen development.
UniProtTranscription factor acting redundantly with MYB21 and MYB57 to control stamen filament elongation in the late developed flowers. Contributes with MYB21 to induction of MYB108 by jasmonate. Repressed at the transcript levels by DELLA proteins. {ECO:0000269|PubMed:16805732, ECO:0000269|PubMed:16972096, ECO:0000269|PubMed:19091873, ECO:0000269|PubMed:19325888, ECO:0000269|PubMed:21447791}.
Function -- GeneRIF ? help Back to Top
  1. results suggest an important role of AtMYB24 in the normal development of anthers
    [PMID: 16972096]
  2. MYB108 and MYB24 have overlapping functions and act downstream of MYB21 in a transcriptional cascade that mediates stamen and pollen maturation in response to jasmonate in Arabidopsis.
    [PMID: 19091873]
  3. Excess expression of MYB24 causes male sterility.
    [PMID: 21447791]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G40350.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by jasmonate. {ECO:0000269|PubMed:16805732}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT3G06490(A)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDGibberellin, jasmonic acid, Jasmonic acid
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G40350, AT5G46760, AT5G46830, AT1G32640
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: No visible phenotype. Myb24 and myb57 double mutant has petals that grew to a final height parallel to the pistil. Myb21 and myb24 double mutant is partialy sterile and has petals that just grew out of the sepals but ended at a lower level than the stigma. Myb21, myb24 and myb57 triple mutant has a strongly reduced fertility and an arrested growth of the petals that never grew out of the sepals. Myb24 and myb108 double mutant has a reduced fertility and a greatly reduced seed set. {ECO:0000269|PubMed:16805732, ECO:0000269|PubMed:19091873, ECO:0000269|PubMed:19325888}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G40350
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1759870.0AF175987.1 Arabidopsis thaliana putative transcription factor (MYB24) mRNA, complete cds.
GenBankAY5196320.0AY519632.1 Arabidopsis thaliana MYB transcription factor (At5g40350) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_198851.11e-160myb domain protein 24
SwissprotQ9SPG91e-161MYB24_ARATH; Transcription factor MYB24
TrEMBLV4M3Y11e-125V4M3Y1_EUTSA; Uncharacterized protein
STRINGAT5G40350.11e-159(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Wang XJ,Cao XL,Hong Y
    Isolation and characterization of flower-specific transcripts in Acacia mangium.
    Tree Physiol., 2005. 25(2): p. 167-78
    [PMID:15574398]
  4. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  5. Mandaokar A, et al.
    Transcriptional regulators of stamen development in Arabidopsis identified by transcriptional profiling.
    Plant J., 2006. 46(6): p. 984-1008
    [PMID:16805732]
  6. Cao D,Cheng H,Wu W,Soo HM,Peng J
    Gibberellin mobilizes distinct DELLA-dependent transcriptomes to regulate seed germination and floral development in Arabidopsis.
    Plant Physiol., 2006. 142(2): p. 509-25
    [PMID:16920880]
  7. Yang XY, et al.
    Over-expression of a flower-specific transcription factor gene AtMYB24 causes aberrant anther development.
    Plant Cell Rep., 2007. 26(2): p. 219-28
    [PMID:16972096]
  8. Mandaokar A,Browse J
    MYB108 acts together with MYB24 to regulate jasmonate-mediated stamen maturation in Arabidopsis.
    Plant Physiol., 2009. 149(2): p. 851-62
    [PMID:19091873]
  9. Cheng H, et al.
    Gibberellin acts through jasmonate to control the expression of MYB21, MYB24, and MYB57 to promote stamen filament growth in Arabidopsis.
    PLoS Genet., 2009. 5(3): p. e1000440
    [PMID:19325888]
  10. Peng J
    Gibberellin and jasmonate crosstalk during stamen development.
    J Integr Plant Biol, 2009. 51(12): p. 1064-70
    [PMID:20021553]
  11. Song S, et al.
    The Jasmonate-ZIM domain proteins interact with the R2R3-MYB transcription factors MYB21 and MYB24 to affect Jasmonate-regulated stamen development in Arabidopsis.
    Plant Cell, 2011. 23(3): p. 1000-13
    [PMID:21447791]
  12. Reeves PH, et al.
    A regulatory network for coordinated flower maturation.
    PLoS Genet., 2012. 8(2): p. e1002506
    [PMID:22346763]
  13. Li Y, et al.
    A cotton gene encoding MYB-like transcription factor is specifically expressed in pollen and is involved in regulation of late anther/pollen development.
    Plant Cell Physiol., 2013. 54(6): p. 893-906
    [PMID:23447105]
  14. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  15. Qi T,Huang H,Song S,Xie D
    Regulation of Jasmonate-Mediated Stamen Development and Seed Production by a bHLH-MYB Complex in Arabidopsis.
    Plant Cell, 2015. 27(6): p. 1620-33
    [PMID:26002869]
  16. Liu Z, et al.
    A Conserved Cytochrome P450 Evolved in Seed Plants Regulates Flower Maturation.
    Mol Plant, 2015. 8(12): p. 1751-65
    [PMID:26388305]
  17. Chen X,Huang H,Qi T,Liu B,Song S
    New perspective of the bHLH-MYB complex in jasmonate-regulated plant fertility in arabidopsis.
    Plant Signal Behav, 2016. 11(2): p. e1135280
    [PMID:26829586]
  18. Huang H, et al.
    Arabidopsis MYB24 Regulates Jasmonate-Mediated Stamen Development.
    Front Plant Sci, 2017. 8: p. 1525
    [PMID:28928760]
  19. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]