PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PH01006106G0050 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 149aa MW: 16707.8 Da PI: 7.5161 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 48.1 | 2.6e-15 | 26 | 86 | 3 | 63 |
XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 + +re+r+ +NRe+ArrsR+RK++ ++eL ++v+ ++aeN + +++ + ++ ++++e+ PH01006106G0050 26 DHRREKRRLSNRESARRSRLRKQQHLDELVQEVARFKAENARVLARANDIAGQYVRVEQEN 86 568***************************************9999999998888888776 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 7.0E-18 | 24 | 88 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 6.8E-11 | 25 | 74 | No hit | No description |
PROSITE profile | PS50217 | 10.818 | 26 | 89 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 9.2E-12 | 27 | 86 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 3.46E-10 | 28 | 82 | No hit | No description |
CDD | cd14702 | 1.71E-15 | 29 | 79 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 31 | 46 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006971 | Biological Process | hypotonic response | ||||
GO:0009267 | Biological Process | cellular response to starvation | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:2000693 | Biological Process | positive regulation of seed maturation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 149 aa Download sequence Send to blast |
MSSSSLSPAG RLSGSDGDSA DIMTADHRRE KRRLSNRESA RRSRLRKQQH LDELVQEVAR 60 FKAENARVLA RANDIAGQYV RVEQENTVLR ARAAELGDRL RSVNEVLRVV EEFSGIAMDI 120 QEECPPDDPL LRPWQIPCPA TAAHMLQY* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 40 | 46 | RRSRLRK |
2 | 40 | 47 | RRSRLRKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | May contribute to developmentally specific patterns of gene expression. Binds specifically to ocs elements which are transcriptional enhancer found in the promoters of several plant genes. OCSBF-1 is able to bind to a site within each half of the ocs element as well as to animal AP-1 and CREB sites. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00419 | DAP | Transfer from AT3G62420 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PH01006106G0050 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FP094800 | 0.0 | FP094800.1 Phyllostachys edulis cDNA clone: bphylf041c24, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003579247.1 | 4e-87 | ocs element-binding factor 1 | ||||
Swissprot | P24068 | 1e-79 | OCS1_MAIZE; Ocs element-binding factor 1 | ||||
TrEMBL | I1IHI8 | 9e-86 | I1IHI8_BRADI; Uncharacterized protein | ||||
STRING | BRADI4G04720.1 | 1e-86 | (Brachypodium distachyon) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1886 | 35 | 100 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G62420.1 | 1e-36 | basic region/leucine zipper motif 53 |
Publications ? help Back to Top | |||
---|---|---|---|
|